KEGG   Burkholderia lata: Bcep18194_B0027
Entry
Bcep18194_B0027   CDS       T00286                                 

Definition
(GenBank) periplasmic sensor signal transduction histidine kinase
  KO
K02480  two-component system, NarL family, sensor kinase [EC:2.7.13.3]
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bur01001]
    Bcep18194_B0027
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bur02022]
    Bcep18194_B0027
Enzymes [BR:bur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Bcep18194_B0027
Protein kinases [BR:bur01001]
 Histidine kinases
  NarL family
   Bcep18194_B0027
Two-component system [BR:bur02022]
 NarL family
  Unclassified
   Bcep18194_B0027
SSDB
Motif
Pfam: sCache_2 dCache_2 HisKA_3 Cache_3-Cache_2 HATPase_c HATPase_c_2 Exonuc_VII_S
Other DBs
NCBI-ProteinID: ABB10144
UniProt: Q39BL7
LinkDB
Position
2:complement(29672..31057)
AA seq 461 aa
MRLKAKIFLLAIVPFLLAIAGIGFGVRQQATSLARTQHATIQAAYLSSKEVELKHYVELA
TSAIMPLYDASGRNARDDAMLRTQALAMLQKMDFGPDGYFFVYDLHGNSLMHPREPERVG
HNYWSMRDPQGALTIQKLIGAAASGGGYVRYAWQRPSTGRVAPKLGYVVALERWGWMVGT
GIYLDDVDTALQRIDARASANIERTMSWLTAIALTGAAAIAVCALVLNVSESRSADAKLK
LLAQRVVESQEQERARLSRELHDGISQMMVSAKLMLESALARFERGTARLPEAEQALASG
VGRLGDTLREVRRISHALRPSMLDDLGLAAALEQLVRELGAESGIDIGYTQVAHSGTRPL
PEAVNTALFRIAQEALSNIVHHAQASRAAVTLDVGAHSVTLTIADNGCGFDAERSQADAR
RGIGLRNMRERLDALGGMLTISSQVGHTIVAARVPLPGAAS
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgagactcaaggcaaagatcttccttctggccatcgtgccgttcctgctcgcgatcgcc
ggcatcggcttcggcgtgcgccagcaggcgacgtccctcgcgcgcacgcagcacgcgacg
atccaggccgcgtacctgtcgagcaaggaagtcgagctgaagcactatgtcgagctggcg
acgagcgcgatcatgccgctctacgacgcgagcggccgcaacgcgcgcgacgacgcgatg
ctccgcacgcaggcgctcgcgatgctgcagaagatggatttcggccccgacggctatttc
ttcgtatacgacctgcacggcaattcgctgatgcatccgcgcgagcccgagcgcgtcggc
cataactactggtcgatgcgcgacccgcagggcgcactgacgatccagaagctgatcggc
gcggcggcgagcggcggcggctacgtgcgctacgcctggcagcggccgtcgacgggccgc
gtcgcgccgaagctcggctacgtcgtcgcgctcgaacgctggggctggatggtcggcacc
ggcatctatctcgacgacgtcgacaccgcgctgcagcgcatcgacgcgcgcgcgtccgcg
aacatcgagcgcacgatgagctggctcaccgcgatcgcgctcacgggtgcggcggcgatc
gccgtgtgcgcgctggtgctgaacgtcagcgagtcgcgcagcgccgacgcgaagctcaag
ctgctcgcgcagcgtgtggtcgaatcgcaggagcaggagcgcgcgcggctatcgcgcgag
ctgcatgacgggatcagccagatgatggtgtccgcgaaactgatgctcgaatccgcgctc
gcccgtttcgaacgcggcacggcgcgcctgcccgaagccgagcaggcgctggcatcgggc
gtcggacggctcggcgacacgctgcgcgaagtgcggcgcatctcgcatgcgctgcgcccc
tccatgctcgacgacctcggcctcgcagccgcactcgaacagctggttcgcgaactcggc
gccgaaagcggcatcgacatcggctatacgcaggtcgcacacagcggcacccggccgctg
cccgaagccgtcaacaccgcgctgttccggatcgcccaggaagcgctcagcaacatcgtg
catcatgcgcaggcgtcgcgcgcggccgtcacgctcgacgtcggcgcacattccgtcacg
ctgaccatcgccgacaacggctgcggcttcgacgccgaacgctcgcaggccgacgcacgc
cgcggcatcggcctgcgcaacatgcgcgagcgcctcgacgcgctcggcggcatgctgacg
atctcgtcgcaggtcggccacacgatcgtcgccgcgcgcgtgccgctgcccggcgccgcg
tcatga

DBGET integrated database retrieval system