KEGG   Burkholderia lata: Bcep18194_B0035
Entry
Bcep18194_B0035   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB
Motif
Pfam: DUF2383 T3SS_needle_reg Coat_F
Other DBs
NCBI-ProteinID: ABB10152
UniProt: Q39BK9
LinkDB
Position
2:40978..41481
AA seq 167 aa
MSNRTHDDGHDARPAKAADESADAQRDALLALLNELLEAERAGARVASETAVEIDDPELH
RLVAGIRQDEAHWCAVLVDAIRSLDATPTHATGAFYEKAMAIDDLAERLAFLNRGQRWVV
RKLQALLPTLAQPDMHHALTQMLVAHEKNIGAVDVQLRIKGGEPGAV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtcgaaccggacccacgacgacgggcacgacgcccgccccgccaaagccgcggacgaa
tccgctgatgcgcagcgcgacgcgttgctcgcgttgctgaatgagctgctggaagccgag
cgcgccggtgcgcgggttgcgtcggagacggcggtggaaatcgacgatcccgaacttcat
cggctggtggccggcattcgacaggatgaggcgcactggtgtgcggtgctggtcgatgcg
attcggtcgctcgatgcgacgccgacgcatgctaccggggcgttctatgagaaggcgatg
gcgatcgatgatctggccgagcggctggcgtttttgaatcgtgggcagcggtgggtcgtg
cggaagttgcaggcgttactgccgacgctcgcgcagccggacatgcatcatgcgctcacg
cagatgctggtggcgcatgagaagaatatcggggcggtggatgtgcagttgcggatcaag
ggcggcgaaccgggcgcagtgtag

DBGET integrated database retrieval system