KEGG   Burkholderia lata: Bcep18194_B1914Help
Entry
Bcep18194_B1914   CDS       T00286                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bur  Burkholderia lata
Pathway
bur00440  Phosphonate and phosphinate metabolism
bur01100  Metabolic pathways
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcep18194_B1914
Enzymes [BR:bur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bcep18194_B1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ABB12028
UniProt: Q394T8
LinkDB All DBs
Position
2:2189928..2191613
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAEDDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGAGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaatttcaccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaagccggcttcaagggcatctgggcatcgggcctcgcgatctccgcgcagttcggc
gtgcgtgacaacaacgaagccagctggacccaggtggtcgacgtgctcgaattcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgccttgtgaagaagctcgagcagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagaccaacagcttcatcggcggcgagcgccagccgctcgccgaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgtgtcgaagcgctgatcgccggctgggggatggacgaggcactgcgccgc
gcgaacgcgtatgcggaagccggcgcggacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgtgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatccgcgatgcaggcgactgcacgcgag
atccacgaaagcgaaacgctgatcaacgtcgaagaccgcgttgcatcggtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggcggccgagcgtatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgcggcgatcgtgctggcagccagccgcggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcgtcaagctcgtcgtcaacgaacgccatgcacagacg
ggcgagctcgcatcgctcgcgtgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcagagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctgacggagaccaaccagagcgtgcgcgatttcgca
ctctgctcggcggaagacgatcgcggcctgttcggccagaagacctacctgcaacgcgtc
tcgagcgacgtcgccgcaggcacgccgcacggccgctggatcggcctgctgaacgtgcgt
ggcgccggcgtcgaccgcctgaaggcgatgctcgcgacgctgcaggcgcgtcctgatttc
gacacgctcgacatcccgtcgctgctcaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgcgcg
ggcgacttcgcgcacggtcaaacgccgctgtccgaaccgggtgccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system