KEGG   Burkholderia lata: Bcep18194_B1954Help
Entry
Bcep18194_B1954   CDS       T00286                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcep18194_B1954
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bcep18194_B1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 HI0933_like DAO K_oxygenase FAD_oxidored Thi4 Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: ABB12067
UniProt: Q394P9
LinkDB All DBs
Position
2:2236490..2238088
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGEYA
FETYFSLSCQNCPEVVQALNVMSLINPCIRHVAIDGALFQSEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKAVTLIEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGDTQRIDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVAPVAAAQPQAEEAVTA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactcaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcctcgctcgacgacagcgcgaaatcgcaggaactgctggcgctgctg
aacgagattgcgtcgctgacggatcgcgtgaccgtaaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgagcccggcaagccggccggcatccgcttcgccggc
atcccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcaaacgggcggccac
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgagtacgcg
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcactgaac
gtgatgtcgctgatcaacccgtgcatccgtcacgtcgcgatcgacggcgcgctgttccag
agcgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggtgcctcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggcgccagc
gcacgtgccgcgaagtcgctcgagaacaagccggtgttcgatacgctgatcgtcggcggc
ggcccggcaggcgcggccgctgcgatctactcggcacgcaagggcattgcgacgggcgtc
gtcgccgaacgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggccgaagttcgcgaccgcgctcgaacagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgacgcgctgattccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcgtcctcgcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggtgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgacctcgccggtatcgtgaaggccgtcacgctgatc
gaatacggcgcgcaactgcgcgcggacgaagtgctgcaacgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcaaacgaccgagctgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatctgcgctcgggtgacacgcagcgcatcgatctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaaggcacggtcgaactg
tcgaagcacggcgagatcgtcgtcgatgctcgcggtgcgacgtcggtgccgggcgtgttt
gccgccggcgacgtaacgacggtgccgttcaagcagatcgtgatcgccgtgggtgaaggc
gcgaaggcatcgctcggcgcgttcgaccacctgatccggcaggacgttgcaccggttgcc
gccgcgcagccgcaagccgaggaagcggtcaccgcgtaa

DBGET integrated database retrieval system