KEGG   Burkholderia lata: Bcep18194_B2249Help
Entry
Bcep18194_B2249   CDS       T00286                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bur  Burkholderia lata
Pathway
bur00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcep18194_B2249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bur02000]
    Bcep18194_B2249
Enzymes [BR:bur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcep18194_B2249
Transporters [BR:bur02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcep18194_B2249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ABB12360
UniProt: Q393K6
LinkDB All DBs
Position
2:2572988..2573656
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELDVPYEIVRYARDPKTMLAPPELRAIHPLGKSPVVTDDG
RTYAESGAIIEYLVERYGNGRLAPPPGTPERHDYTYWLHYAEGSAMPPLLLKLVALRIAH
APMPFFARPISRKIADTLQSSFVDPQIALHLGYLDDTLSRTGWFVGDRFSAADIQMSFPL
EAATARGGGSRYPAIARFLDAIHARPAYQRALERGGPYDLLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgtccatcacctgaacaactcgcgctcgcagcgcgtgctctggctgctcgaa
gaactggatgtgccgtacgagatcgtgcgctacgcacgcgatccgaaaacgatgctcgcg
ccgcccgagttgcgcgcgatccatccgctcggcaagtcgccggtcgtcaccgacgacggc
cgcacgtacgccgaatcgggcgcgatcatcgaatacctggtcgaacgctacggcaacggg
cgcctggcgccgccgcccggcacgcccgagcggcatgactacacgtactggctgcactac
gcggaagggtcggcgatgccgccgctgctgctcaagctcgtcgcgctgcggatcgcgcat
gcgccgatgccgttcttcgcccggccgatctcgcgcaagatcgcggacacgctgcagtcg
agcttcgtcgatccgcagatcgccctgcatctcggctatctcgacgacacgttgagccgc
accggctggttcgttggcgatcgcttcagcgcagccgacatccagatgagctttccgctc
gaagccgcgaccgcgcgcgggggcggcagccggtatcccgcgatcgcgcgcttcctcgac
gcgatccacgcgcggcccgcgtaccagcgggcgctggagcgcggcggcccgtacgacctg
ctcaagtaa

DBGET integrated database retrieval system