KEGG   Burkholderia lata: Bcep18194_B2557Help
Entry
Bcep18194_B2557   CDS       T00286                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bur  Burkholderia lata
Pathway
bur00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcep18194_B2557
Enzymes [BR:bur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcep18194_B2557
Transporters [BR:bur02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcep18194_B2557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ABB12668
UniProt: Q392E8
LinkDB All DBs
Position
2:complement(2907893..2908510)
Genome map
AA seq 205 aa AA seqDB search
MKLYGFAGTRSQRALWGLKELDADFEFISVNLLQGEHKRPEFLRLNPAGKVPVLVDGDLV
IPESAAIVLYLADKYPEKALLPVDPALRAEAYRWVMFAVTELEQPLWRITRHSFIYPPEK
RSPADIELAREDFKTMAAILDKHLEGREFIVGDTLTVADCVTAYLIDWAGECNLIESFPQ
LRAYLERLYARPKAPQRIADARKAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacggatttgccggcacccgctcgcaacgcgcgctgtgggggctgaaagaa
ctggatgccgatttcgagttcatctcggtgaacctgctccagggcgagcacaagcggccc
gaattcctgcgcctcaatccggccggcaaggtgccggtgctggtggacggcgacctcgtg
attcccgagtcggccgcgatcgtgctgtatctcgcggacaagtacccggagaaggcattg
ctgccggttgatcccgcgttgcgggccgaggcttaccggtgggtcatgttcgcggtgacg
gagctcgagcagccgctgtggcggatcacgcggcattcgttcatctatccgccggagaag
cgctcgccggccgatatcgagctggcgcgcgaggatttcaagacgatggctgcgatcctc
gacaagcatctcgaagggcgcgagttcatcgtcggcgacacgctgacggtggccgattgc
gtgaccgcttacctgatcgactgggcgggcgagtgcaacctgatcgaatcgtttccgcaa
ttgcgtgcgtatctcgaacggctgtatgcgcggccgaaggcaccgcagcggatcgcggac
gcgcgcaaggcggcgtga

DBGET integrated database retrieval system