KEGG   Burkholderia lata: Bcep18194_B3145Help
Entry
Bcep18194_B3145   CDS       T00286                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ABB13255
UniProt: Q38ZW1
LinkDB All DBs
Position
2:complement(3547905..3548885)
Genome map
AA seq 326 aa AA seqDB search
MTNSTVFSRTRGSTADVPVRDRMAYWDAFNAATLVGLRCSSLSPAGLEVEKTDIALPGLG
IADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQRDRCLLADAGDVVVYDTRVP
YLFGFLTPMRQLLIDIPITTFDDRLDAELAALPLRIAPKPGAGAMLGATLRASVERFMKD
PVEHDATRFAEHTRTLIAELIDAEVNGAGASRASLSYLLTAKQYIATHLGDPELAPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDARLRKTSVGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAARADGS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttttttcccgcacgcgaggctcgacggccgacgtgccggtgcgc
gacaggatggcgtactgggacgcgttcaatgcggcgacgctggtcgggctgcgttgctcg
tcgttgtcgccggccgggctcgaggtcgagaagaccgatatcgcgctgccgggcctcggc
atcgcggacatcagcggccaggatcacgtgatcgagcgcagccccgcgctggtgcgccag
ttgccgaaggagtcgctgtttgcgtgccagatcctgagcgggcgcgcgtatttcatccag
cgggaccgctgcctgctcgcggacgccggcgatgtcgtcgtctacgacacgcgcgtgccc
tatctgttcggattcctgacaccgatgcggcagctgctgatcgatattccgatcacgacg
ttcgacgaccggctcgatgcggagctggccgcgctgccgctgcggatcgcgccgaagccg
ggcgcgggcgcgatgctcggtgcgacgttgcgcgcgagcgtcgagcgcttcatgaaggat
ccggtcgagcatgacgccacgcggttcgccgaacacacgcgcacgctgatcgccgagctc
atcgatgcagaggtgaacggtgcgggtgcttcgcgcgcgtcgctgtcgtatctgctgacc
gcgaagcagtacatcgcgacgcatctcggcgacccggaactcgcgccgcaggccgtcgcg
gacgcggtcgggctgtcgctgcggcatctgggccggctcttcgcggccgaaggcgagtcg
atcacgcagcacatctggtcggagcggctgtcgcatgcgcatcgcgagctgaccgatgcg
cggctgcgcaagacgagcgtcggcgaaatcgcgttccgctggggattttcgagccaggcg
cacttcagtcgtgcgattcgtgagcgctatggtgcgtcgccgatggcgctgcgcgacgcg
gcgcgggcggatgggagctga

DBGET integrated database retrieval system