KEGG   Burkholderia lata: Bcep18194_B3147Help
Entry
Bcep18194_B3147   CDS       T00286                                 

Definition
(GenBank) Major facilitator superfamily (MFS_1) transporter
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ABB13257
UniProt: Q38ZV9
LinkDB All DBs
Position
2:3549616..3550920
Genome map
AA seq 434 aa AA seqDB search
MTSPSSPRSAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSAELHLTNTQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAYGWREAFYVSC
VPGFLIAFCIWRWVREVPPGGVRHAQADTAGTPAASGAAVSRWALLKERNILLCMLISCF
FLTWFIVIISFAPVFLVESRHLSPSDMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIA
FALIAAVCPIVLIHAGSLWVLCALVFATYTGLGCFTLFMATIPAETVPPRAIASALGLIM
GAGELIGGFVAPTVAGFAADKYGLQFAMWTSAAGAILACVLSFGLVETAPAVLRKRALAG
SAASRLDAQNLGGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacatctccttcctccccccgatccgcctggacgtacgagaaccggctgctgctgatc
ctgttcatgacgttcggcttcgtgttcttcgaccgcctcgcgctgtcgttcctgttcccg
ttcatgtcggccgagctgcacctgacgaacacgcagctcggcatggtgtcgtccgcgctc
gcgctcacgtgggcattgtccggtgccgcgacgggcgcgtggtccgacgcgcgcggcacg
cgcaagccgctgctgatcgcggccgtgctcggcttttccgtgtgttcggcgctgtcgggg
ctcgtcggcggcttcgcgagcctgatcgcgttccgcgcgctgatgggcatcgccgaaggc
cccgtgctgccgctgtcgcaatcgctgatggtcgaaagctcgacgccgagccgccgcggg
ctgaacatgggcctgctgcaaggctccgccgccggcctgctcggcgcgatgatcggcccg
ccggtggtcatcggcatcgcaaccgcgtacggctggcgcgaggcgttctacgtgtcgtgc
gttccgggcttcctgatcgcgttctgcatctggcgctgggtgcgcgaagtgccgcccggc
ggcgtgcggcacgcgcaggccgataccgccggcacgccggccgcgagcggcgcggcagtc
agccgctgggcgttgctgaaggaacgcaacatcctgctctgcatgctgatcagttgcttc
tttctcacgtggttcatcgtgatcatctcgttcgcgccggtgttcctcgtggaaagccgc
cacctgtcgccgtccgacatgggcgtcgtgatgacctgcctcggcgccgcgtgggtgttc
tggggcttcgcggtgccggcgatctccgaccggatcggccgcaagccgacgatgatcgcg
ttcgcactgatcgcggccgtgtgcccgatcgtgctgatccatgccggctcgctgtgggtg
ctctgtgcgctcgtgttcgccacctacacgggcctcggctgcttcacgctgttcatggcg
acgatccccgccgaaacggtgccgccgcgcgcgatcgccagcgcgctcggcctgatcatg
ggcgcgggcgagttgatcggcggcttcgttgcgccgaccgtcgccggcttcgcggccgac
aagtacggcttgcagttcgcgatgtggacgtcggccgccggcgcgatcctcgcatgcgtg
ctgtcgttcggcctcgtcgaaaccgcgcccgccgtgctgcgcaagcgcgcgctcgccggc
tcggccgcgagccgtctcgatgcgcaaaacctcggaggtcgctga

DBGET integrated database retrieval system