KEGG   Burkholderia lata: Bcep18194_B3148Help
Entry
Bcep18194_B3148   CDS       T00286                                 

Definition
(GenBank) Zinc-containing alcohol dehydrogenase superfamily
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bur  Burkholderia lata
Pathway
bur00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcep18194_B3148
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bcep18194_B3148
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bcep18194_B3148
    1.1.1.-  
     Bcep18194_B3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C Methyltransf_25 DZR
Motif
Other DBs
NCBI-ProteinID: ABB13258
UniProt: Q38ZV8
LinkDB All DBs
Position
2:3550922..3552043
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDVRLVEIDTPRVGPGDVRIAVAYCGICGSDLHEYADGPHAIPVDTPHPLS
RRTAPLTLGHEFCGTVVEVGEGVTALRAGDRVAVEPEYRCSQCAYCRSGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDGVSLEQAAVMEPAAVALHALRRGELRLGETCAVFGL
GPIGLLLIMLAKLQGATTIVAVDVSPERLAAATRFGATHTFDARALGASALQDAIRAATG
GLGVDASFEAAGLQTTFESAMHALRKGGRIVMVGLMPHAGFDAFRAVNDELTFTASVGYR
HAYEDLLRIVASGALDLTSIVTRTVSLEDAVADGFDALLADRAQIKILVSPAQRPPRRAH
TIGSIEHESSVGV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcacttcaatggcatggcccgcgcgacgtccgtctcgtggaaatcgacacgccg
cgcgtcggcccaggcgacgtgcgcatcgcggtcgcgtattgcgggatctgcggcagcgac
ctgcacgaatatgcggacggcccgcacgcgatcccggtcgacacgccgcatccgctgtct
cgccgtaccgcgccgctgacgctcggccacgagttctgcggcaccgtcgtcgaagtcggc
gaaggcgtgacggcgctgcgcgcgggcgatcgcgtcgcggtcgagcccgagtatcgctgc
agccagtgcgcgtactgccgctcggggtcgtacaacctgtgcgtgtcgatgggcttcgcc
gggctgatgggcgacggcggcatggccgacttcgcggtcgtgccggcgtacatgctgcat
cgcttgcccgacggcgtgagtctcgaacaggccgcggtgatggagccggcggccgtcgcg
ctgcacgcgttgcggcgtggcgagctgcggctcggcgaaacctgtgcggtgttcggcctc
gggccgatcggcctgttgctgatcatgctcgcgaagctgcagggcgcgaccacgatcgtg
gctgtcgatgtctcgcccgaacggctcgcggcggccacgcgcttcggcgcaacgcatacg
ttcgatgcacgcgcactcggtgcatccgcactgcaggacgcgatccgcgcggccacgggc
gggctcggcgtcgatgcgagtttcgaagcggccgggctgcagacaacgttcgaatcggcg
atgcacgcgctgcgcaagggtggacgcatcgtgatggtcggcctgatgccgcatgcgggc
ttcgacgcgttccgcgcggtcaacgacgagctgaccttcacggcgagcgtcggctaccgg
catgcgtacgaagacctgctgcgcatcgtcgcgtcgggtgcgctcgacctcacgtcgatc
gtcacgcgcaccgtgtcgctcgaagacgccgtcgccgacggcttcgacgcgctgctcgcc
gaccgcgcgcagatcaagatcctcgtttcacccgcgcaacggcctccccgtcgcgcgcac
accatcgggagcatcgagcatgagtcgtcagtgggcgtttga

DBGET integrated database retrieval system