KEGG   Burkholderia lata: Bcep18194_C6699
Entry
Bcep18194_C6699   CDS       T00286                                 

Definition
(GenBank) Indoleacetate--lysine ligase
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcep18194_C6699
Enzymes [BR:bur01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     Bcep18194_C6699
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: ABB05749
UniProt: Q39P67
LinkDB
Position
3:213390..214625
AA seq 411 aa
MSDRTTRFDSSAVSEALSYDARYAHVLPTGVASYAAFRTLVAIETADDLKRRVLDHLDHD
DLAGATFYTTSGTSGDVKLLLNAPARKRPDTTYGRALANALAGTAIAPTDRVANLFTAGG
FSTLYDGVNRLLEAIGANVLPIGRLDAYGADLPAMLNLIGRARPNVLVGTPTSVLQCLRL
LDAHGVDLDVTKILYTGEAFPERKRAIVRRRWPDAACFGLYGATETGFLGYHTPRCAEGH
YHVLDDWFFLEEEDGQLLVTSRANPGLAMLRYRLGDRVRVGPSVRCTCGEGGSVVVLQGR
ADQRFKFAGNLVSTELLAQRLAACVGRPLDCQFRLDADAHGRDCLTVVLDLGDDELAPLA
SRLTDALLEIEDVRECIDKGEGRLDVLGRDALRYSARQKLPRLIDERHAHV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtccgaccgcacgacccgcttcgattcctcggccgtgagcgaagcgctttcgtacgat
gcccgctatgcgcatgtgctgccgacgggcgtggccagctacgcggccttccgcacgctg
gtcgcgatcgagacggccgacgacctgaagcggcgcgtgctcgaccatctcgatcacgac
gatctggccggcgcgacgttctacaccacgtcgggcacgagcggcgacgtgaagctgctg
ctcaacgcgccggcgcgcaagcggcccgacacgacctatggccgggcgctcgcgaacgcg
ctggcgggaacggcgatcgcgccgacggaccgggtggcgaacctgtttaccgccggcggc
ttctccacgctgtacgacggcgtgaaccggctgctggaagcgatcggcgcgaacgtactc
ccgatcgggcggctggacgcctacggcgccgatttgccggcgatgctgaacctgatcggc
cgcgcccgcccgaacgtcctggtcggcacgccgacgagcgtgctgcaatgcctgcggctg
ctcgacgcgcacggtgtcgatctcgacgtcacgaagatcctctacaccggcgaggcgttc
cccgagcgcaagcgcgcgatcgtgcggcggcgctggcccgatgcggcatgcttcgggctg
tacggcgccaccgaaacgggctttctcggctatcacacgccgcgctgcgcggaagggcat
taccacgtgctcgacgactggttcttcctcgaggaggaggacgggcagctcctcgtgacg
agccgcgcgaaccctggcctcgcgatgctgcgctaccggctcggcgatcgcgtgcgcgtc
gggccgtcggtgcgctgcacgtgcggcgagggcggctcggtcgtcgtgctgcagggccgc
gcggatcagcgcttcaagtttgcgggcaacctcgtcagcaccgagctgctcgcgcagcgg
ctggcggcgtgcgtcggccggccgctcgattgccagtttcgcctggacgccgacgcgcac
gggcgcgactgcctgaccgtcgtgctggatctgggcgacgacgaactcgcgccgctcgcg
tcacggctgaccgacgcgctgctggagatcgaggacgtgcgcgaatgcatcgacaagggc
gagggtcgcctcgacgtgctcggtcgcgacgcattgcgctactccgcgcgccagaagctg
ccgcgcctgatcgacgagaggcatgcccatgtctga

DBGET integrated database retrieval system