KEGG   Burkholderia lata: Bcep18194_C6861
Entry
Bcep18194_C6861   CDS       T00286                                 

Definition
(GenBank) 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
bur  Burkholderia lata
Pathway
bur00997  Biosynthesis of various secondary metabolites - part 3
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Bcep18194_C6861
Enzymes [BR:bur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     Bcep18194_C6861
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: ABB05907
UniProt: Q39NQ9
LinkDB
Position
3:404819..405619
AA seq 266 aa
MNALLSVSGKALRMRRVVRAASGKCLMVPLDHSLADGPIAHPQQLRQLVGDIAVHGGDAI
VVHRGRARFLSPDVLNDLALVVHLNGCTRYAEDVNAKTLFASVEDALACGADAVSVHVNL
GSKTESQQLLDLSRIATECARWSLPLLAMIYPRGPGLGDRPQTELIAHAANVAADLGADI
VKLPYSGDAASMADIIAGSSLPVLVAGGAKLPEDEFVAFTSRVMNAGALGIAAGRNVFAA
PKAAPLIRRLSDAVHGVERRAAHLAA
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaacgctcttctatcggtttctggcaaggcgctcaggatgcggcgggtggtgcgtgcc
gcgtcgggcaagtgcctgatggtgccgctcgatcattcgctcgcggacgggcccatcgcc
catccgcagcagttgcggcaactggttggcgacatcgccgtgcatggcggcgatgcgatc
gtcgtgcatcgcggccgcgcgcgcttcctgtcgcccgacgtgctgaacgatctcgcgctc
gtcgtgcacctgaacggctgcacgcgctacgcggaggacgtgaacgcgaagacgctgttc
gcgagcgtcgaggatgcgctggcatgcggcgcggacgcggtcagcgtgcacgtgaatctc
ggctcgaagacggaaagccagcaactgctcgacctgagccgcatcgcgaccgagtgtgcg
cgctggtcgctgccgctgctcgcgatgatctatccgcgcggcccgggcctcggcgatcgt
ccgcagaccgaactgattgcccacgcggcgaacgtcgcggcggatctcggcgccgacatc
gtcaagctgccgtacagcggcgatgccgcgagcatggccgacatcatcgccggctcgtcg
ctgccggtgctggtcgcgggcggcgcgaagctgccggaagacgagttcgtcgcgttcacg
tcgcgcgtgatgaatgcaggtgcgctcggcattgcagccggccgcaacgtgttcgccgcg
ccgaaggccgcaccgctgatccgccgcctgtccgatgccgtgcacggcgtcgagcggcgt
gccgcgcacctggccgcctga

DBGET integrated database retrieval system