KEGG   Burkholderia lata: Bcep18194_C7033Help
Entry
Bcep18194_C7033   CDS       T00286                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bur  Burkholderia lata
Pathway
bur00500  Starch and sucrose metabolism
bur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcep18194_C7033
Enzymes [BR:bur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bcep18194_C7033
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Bcep18194_C7033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABB06078
UniProt: Q39N88
LinkDB All DBs
Position
3:complement(595703..599119)
Genome map
AA seq 1138 aa AA seqDB search
MMKREDSLDDVRRAQFPSLAPGGTPRRRRARRRAPALCADDPLWYKDAIIYQVHVKSFYD
SNNDGIGDFPGLIAKLDYIAELGVDTIWLLPFYPSPRRDDGYDIADYRDVHPDYGTLADV
RRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSTHRDYYVWSDTDTKYAGTRI
IFLDTETSNWAHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVMQVMRFWLDLGIDGLRLD
AVPYLVAREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGDEDEC
HMAFHFPLMPRIYMSIASEDRFPIVDIMRQTPELAPSNQWAVFLRNHDELTLEMVTDSER
DLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGD
NIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAVNVEAQTRDPHSLL
NWTRRILSTRRASQAFGRGTIRFLRPENRKVLAYLRELDGDDPVLCVANLSRASQAVELD
LSEFAGRVPIEMTSDSPFPPIGQLPYLLTFPPYGFLWFVLAEHGREPSWRQPHAEPLPEY
VTLVMRRGDARPDIEQLHVLAHDALPSWLARRRWFASKDRAIGAARLNVVTPVPGEPFQY
AEAWVESDEPGDVERYVVPLAAAWGGETSQPLFAQLALARVRRGHSVGYLTDAFALPAFA
HGMLRKLRDGATVPTSDDGRLAFLPEDALAALDPGDNADVRWLAAEQSNSSLVIGDAIVL
KLVRKVAHGVHPEAEMSRYLTRIGYPNTATLAGEVVHVDPDGTPHTVAILQRYADNQGDA
WTRSFDFLRRAVDELALPAADEEEPDDTDEEPDALLGYAAFAGIIGTRLGQLHVALAQPS
DDPAFAPEHATPEHVDGWCADAIASFEHALDVLHTRLDALDPATRAAADTLLASRDAAVR
ALGELVPRTLDAQCIRIHGDFHLGQVLDVQGDALLIDFEGEPARPLERRRAKSHPLRDVA
GLLRSLSYVSAIAQFAIEKAPPQAAGRKRALFDRFGQAAADRFVDCYRAAAELAPARFVD
PRYAYRLLALFLIDKASYELCYEAANRPDWLSVPVGGLAALVERLLDGGAASDDGDTP
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgcgaagattccctcgacgacgtacgccgcgcgcaattcccgtcgctcgcg
ccgggcggcacaccacgccggcgccgtgcacgccgccgcgcgccggcgctctgcgcggac
gatccgctgtggtacaaggacgcgatcatctaccaggtgcacgtgaagtcgttctacgac
tcgaacaacgacggcatcggcgatttccccggcctgatcgcgaaactcgactacatcgcc
gaactcggcgtcgacacgatctggctgctgccgttctacccgtcaccgcgccgcgacgac
ggctacgacatcgccgattaccgcgacgtgcatcccgactacggcacgctggccgacgtg
cggcgcttcatccgcgaagcgcatgcgcgcggcatccgcgtgatcaccgagctggtgatc
aaccacacgtcggaccagcatccgtggttccagcgcgcgcgccgcgcgaaaccgggttcg
acgcaccgcgactattacgtgtggtccgacaccgacacgaaatacgcgggcacgcggatc
atcttcctcgatacggaaacgtcgaactgggcgcacgacccggtcgccggccagtactac
tggcaccgcttctattcgcaccagccggacctgaacttcgacaacccggccgtcgtgcgc
gaggtgatgcaggtgatgcgcttctggctcgatctcggcatcgacgggctgcggctcgac
gcggtgccgtatctcgtcgcgcgcgagggcaccaacaacgagaacctgcccgagacgcac
gcgatcctgaagcggatccgcgcgacgatcgacgccgagtacccgaaccggatgctgctc
gcggaggcgaaccagtggccggaagacgtgcaggaatatttcggcgacgaggacgaatgc
cacatggcgttccacttcccgctgatgccgcgcatctacatgtcgatcgcgagcgaggat
cgcttcccgatcgtcgacatcatgcggcagacaccggaactcgcaccgagcaaccagtgg
gccgtgttcctgcgcaaccacgacgagctgacgctcgagatggtcaccgactccgagcgc
gatctgttgtggcagacctatgcgagcgaccggcgcgcgcggctgaacctcggcatccgg
cgccggctcgcgccgctgatggaacgcgaccggcgccgcatcgagctgatcaactcgctg
ctgctgtcgatgccgggcacgccggtgatctactacggcgacgaactcgggatgggcgac
aacatccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgtcggatcgc
aacggcggcttctcgcgcgccgacccggaactgctcgtgctgccgccggtgatgggttcg
ctgtacggctatgacgcggtcaacgtcgaggcgcagacacgcgacccgcattcgctgctg
aactggacgcgccgcatcctgtcgacgcgccgcgcgtcgcaggcgttcggacgcggcacg
atccgcttcctgcgcccggagaaccgcaaggtgctcgcgtacctgcgcgagctggacggc
gacgatccggtgctgtgcgtcgcgaacctgtcgcgcgcgtcgcaggccgtcgagctcgac
ctgtccgaattcgcgggccgcgtgccgatcgagatgacgtcggattcgccgtttccgccg
atcggccagctcccgtatctcctcaccttcccgccgtacggattcctgtggttcgtgctc
gccgagcatggccgcgagccgtcgtggcggcagccccatgcggagccgctgcccgaatac
gtgacgctcgtgatgcggcgcggcgatgcgcggccggacatcgaacagctgcacgtgctc
gcgcacgatgcgttgccgtcgtggctcgcgcggcggcgctggttcgcgtcgaaggaccgt
gcgatcggcgcggcccggctgaacgtcgtcacgccggtgccgggcgaaccgttccagtat
gcggaggcgtgggtcgaatccgatgagccaggcgacgtcgaacgctacgtcgtgccgctc
gcggccgcgtggggcggtgaaacctcgcagccgctgttcgcgcagctcgcgctggcgcgt
gtgcggcgcggccattcggtcggctacctgaccgacgcgttcgcgctgccggcgttcgca
cacgggatgctgcgcaagctgcgcgacggcgcgacggtgccgacctccgatgacggccgg
ctcgcgttcctgccggaagacgcgctcgccgcgctcgatcccggcgacaacgccgacgtg
cgctggctcgcggccgagcagagcaacagctcgctcgtgatcggcgacgcgatcgtgctg
aaactggtgcgcaaggtcgcgcacggcgtgcatccggaagcggaaatgagccgctacctg
acgcggatcggctacccgaacaccgcgacgctcgccggtgaagtcgtgcacgtcgatccg
gacggcacgccgcatacggtcgcgatcctgcagcgctacgccgacaaccagggcgatgcg
tggacgcgctcgttcgatttcctgcgccgcgcagtggacgagctcgcgctgccggccgcg
gacgaagaagagcccgacgatacggacgaggaacccgacgcgctgctcggctatgcggcg
ttcgcggggatcatcggcacgcggctcggccagttgcacgtcgcgctcgcgcagccgtcc
gacgatccggcgttcgcgccggagcacgcgacgcccgaacacgtcgacggctggtgcgcg
gacgcgatcgcatcgttcgaacacgcgctcgacgtgctgcacacgcggctcgatgcgctc
gatcccgcgacgcgcgcggcggccgacacgctgctcgcgtcgcgcgatgcggccgtgcgc
gcgctcggcgagctcgtgccgcgcacgctcgatgcgcaatgcatccggatccacggcgat
ttccatctgggccaggtgctcgacgtgcagggcgacgcgctactgatcgacttcgaaggc
gagccggcacgcccgctcgagcggcgccgcgcgaaatcgcatccgctgcgcgacgtggcc
ggcctgctgcggtcactgtcgtatgtgagcgcaatcgcgcaattcgcgatcgagaaggcg
ccaccgcaggcggccggccgcaagcgcgcgctgttcgaccgcttcgggcaggccgccgcc
gaccgcttcgtcgactgctatcgcgcggccgccgaactcgcccccgcgcgtttcgtcgac
ccgcgctacgcctatcgcctgctcgcgctgttcctgatcgacaaggcgtcgtacgagctg
tgctacgaagccgcgaaccggcccgactggctaagcgtgccggtcggcgggctcgcggcg
ctggtcgaacggctgctcgatggcggcgccgcctccgacgacggagacacgccatga

DBGET integrated database retrieval system