KEGG   Burkholderia pseudomallei TSV202: X994_1837Help
Entry
X994_1837         CDS       T03428                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00020  Citrate cycle (TCA cycle)
but00480  Glutathione metabolism
but01100  Metabolic pathways
but01110  Biosynthesis of secondary metabolites
but01120  Microbial metabolism in diverse environments
but01130  Biosynthesis of antibiotics
but01200  Carbon metabolism
but01210  2-Oxocarboxylic acid metabolism
but01230  Biosynthesis of amino acids
Module
but_M00009  Citrate cycle (TCA cycle, Krebs cycle)
but_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X994_1837 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    X994_1837 (icd)
Enzymes [BR:but01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     X994_1837 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIV78833
UniProt: A0A069B574
LinkDB All DBs
Structure
PDB: 

Position
1:complement(2136272..2137531)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPQTSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GAFRDAGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVVKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIISAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENME
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcatcccttacatcgagggcgacggcacgggc
ttcgacatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagattcactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggcccggacgtgtggctgccggaagagacgctgcaggtgctgaaggaatacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtctgcctgcgcccgatccagtacttcaagggcgtgcct
tcgcccgtgcgcgagccggagaagaccaacatggtcatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggcggccgaatccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccgcagacctcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggcgcgttccgtgacgccggctatgcgctcgcgcagaaggaattcggcgccgagctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtggtcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgctcgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaacccgggttcggaaatcctg
tcggccgaaatgatgctgcgccacctcggctggaccgaagcggccgacgtgatcatttcc
gcgatggagaagtcgatcaagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatggagtaa

DBGET integrated database retrieval system