KEGG   Burkholderia pseudomallei TSV202: X994_2732Help
Entry
X994_2732         CDS       T03428                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00010  Glycolysis / Gluconeogenesis
but00620  Pyruvate metabolism
but01100  Metabolic pathways
but01110  Biosynthesis of secondary metabolites
but01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:but00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    X994_2732 (acoD)
   00620 Pyruvate metabolism
    X994_2732 (acoD)
Enzymes [BR:but01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     X994_2732 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIV80088
UniProt: A0A069BCJ1
LinkDB All DBs
Position
1:complement(3165361..3166881)
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGRPFTAIPRSREADIEL
ALDAAHAAKAGWAAKGAAERANVLLRIADRMEANLTRLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYDRFIERALKRVEAIKQGHPLDSQTMIGAQASAEQLEKILSYIDIGR
GEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaattcccgtaccgcaagcagtacggg
aatttcatcggcggcgaatgggtcgccccggtcggcggcgagtatttcgacaacgtctcg
cccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgaagccgacatcgagctc
gcgctcgacgccgctcacgcggccaaggcgggctgggccgcgaagggcgcggccgagcgc
gcgaacgtgctgctgaggatcgccgaccggatggaggcgaacctcacgcgcctcgccgtc
gccgagacgatcgacaacggcaagccgctgcgcgaaaccaccgcggccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gatatcggcggcgacatggtggcctaccacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaacttcccgctgctgatggccgcgtggaagctcgcgccggcgctcgcg
gccggcaactgcgtcgtgctcaagccggccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctcaacatcgtcaacggcttcggc
ctcgaggccggcaagccgctcgcgtcgagcaagcggatcgcgaagatcgcgttcacgggc
gagacgtcgacgggccgcctcatcatgcagtacgcgagcgagaacctgattcccgtcacg
ctcgagctgggcggcaagagcccgaatattttcttcgccgacgtgatggatcgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaagtc
tgcacgtgcccatcgcgcgcgctcgtcgaggagagcatctacgatcgcttcatcgaacgc
gcgctcaagcgcgtcgaggcgatcaagcagggccatccgctcgattcgcagacgatgatc
ggcgcgcaggcgtcggccgagcagctcgagaagatcctgtcgtacatcgacatcggccgc
ggcgaaggcgcgcaatgcctgacgggcggcgagcgcaacgtgctcggcggcgagctcgcc
gaaggctattacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagaaatcttcgggccggtgctcgcggtgacgacgttcaagaccgaggaggaagcgctc
gagatcgcgaacgacacgctgtacggcctgggcgccggcgtctggacgcgcgacggcaac
cgcgcgtaccgcttcggccgcggtatccaggcgggccgcgtgtggacgaactgctatcac
gcgtatccggcgcacgcggcgttcggcggctacaagcaatccggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtcagctacagcgaa
aagccgctcgggttcttctga

DBGET integrated database retrieval system