KEGG   Burkholderia pseudomallei TSV202: X994_2965Help
Entry
X994_2965         CDS       T03428                                 

Definition
(GenBank) AAA domain protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00400  Phenylalanine, tyrosine and tryptophan biosynthesis
but01100  Metabolic pathways
but01110  Biosynthesis of secondary metabolites
but01130  Biosynthesis of antibiotics
but01230  Biosynthesis of amino acids
Module
but_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    X994_2965
Enzymes [BR:but01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     X994_2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA AAA_25 FtsK_gamma AAA_16 APS_kinase TsaE AAA_22 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AIV77524
UniProt: A0A1S0SQM7
LinkDB All DBs
Position
1:3405075..3405629
Genome map
AA seq 184 aa AA seqDB search
MQARDPHVNVIFVGLMGAGKTTVGRAVARRLDRPFFDSDHEIEARTGARIPVIFELEGEA
GFRDREAQMIAELTQRENIVLATGGGAILRPENRKLLHERGLVVYLRANPHDLWLRTRKD
KNRPLLQTDDPKAKLEALYEARDPLYRECAHFVIETGRPSVNGLVNMVLMQLEMAGIVAK
PLQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcgcgggacccacacgtgaacgtaattttcgtcgggctcatgggggcgggtaag
accaccgtgggccgggcggtcgcgcgccggctcgacagacccttcttcgattcggatcat
gagatcgaggcgcgcaccggcgcgcgcattccggtcatcttcgaactcgagggcgaagcg
ggcttccgtgaccgcgaggcgcagatgatcgccgagctcacgcagcgcgagaacatcgtg
ctggcgacgggcggcggcgcgatcctgcgccccgagaaccgcaagctgcttcacgaacgg
ggcctcgtcgtctatctgcgcgcgaatccgcacgatctctggctgcgcacccgcaaggac
aagaatcgcccgctgttgcagaccgacgatccgaaagccaagctcgaagcgctgtacgaa
gcgcgcgatccgctctaccgcgaatgcgcgcacttcgtcatcgaaaccgggcggccgtcc
gtcaacgggctcgtcaacatggtgctgatgcagctcgaaatggcgggcatcgtcgccaag
ccactccaagcatga

DBGET integrated database retrieval system