KEGG   Burkholderia pseudomallei TSV202: X994_380Help
Entry
X994_380          CDS       T03428                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00061  Fatty acid biosynthesis
but00780  Biotin metabolism
but01100  Metabolic pathways
but01130  Biosynthesis of antibiotics
but01212  Fatty acid metabolism
Module
but_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    X994_380
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    X994_380
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    X994_380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:but01004]
    X994_380
Enzymes [BR:but01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     X994_380
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     X994_380
Lipid biosynthesis proteins [BR:but01004]
 Fatty acid synthase
  Component type
   X994_380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: AIV79333
LinkDB All DBs
Structure
PDB: 

Position
1:complement(439746..440537)
Genome map
AA seq 263 aa AA seqDB search
MGFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELV
FPCDVADDAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDIS
AYSFPALAKAALPMLSDNASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAK
GVRVNAISAGPIKTLAASGIKSFGKILDFVESNSPLKRNVTIEQVGNAGAFLLSDLASGV
TAEVMHVDSGFNAVVGGMAGLGE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgacggtaaacgtattctgctgacgggcctcttgtcgaaccgttcgatc
gcttacggcatcgccaaggcgtgcaagcgcgaaggcgccgagctggcgttcacctacgtc
ggcgatcgcttcaaggatcgcatcaccgagttcgcggccgagttcggcagcgaactcgtg
ttcccgtgcgatgtcgccgacgatgcgcagatcgatgcgctcttcgcgtcgctgaagaca
cactgggattcgctcgacggcctcgtccactcgatcggcttcgcgccgcgcgaggcgatc
gcgggcgacttcctcgacggcctcacgcgcgagaacttccgcatcgcgcacgacatctcc
gcatacagcttccccgcgctcgcgaaggcggcgctgccgatgctgtcggacaatgcgtcg
ctgctcacgctgtcgtatctcggcgcggagcgggcgatcccgaactacaacacgatgggc
ctcgcgaaggcggcgctcgaggcgagcgtgcgctatctcgcggtgtcgctcggcgcgaag
ggcgtgcgcgtgaacgcgatctcggcgggcccgatcaagacgctcgcggcaagcggcatc
aagagcttcggcaagatcctcgatttcgtcgagagcaactcgccgctcaagcgcaacgtg
acgatcgagcaggtcggcaacgcgggcgcgttcctgctgtcggacctcgcgagcggcgtc
acggccgaagtcatgcacgtcgactcgggcttcaacgcggtggtgggcgggatggccggc
ctcggggaataa

DBGET integrated database retrieval system