KEGG   Burkholderia pseudomallei TSV202: X994_4116Help
Entry
X994_4116         CDS       T03428                                 

Definition
(GenBank) fusaric acid resistance family protein
Organism
but  Burkholderia pseudomallei TSV202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUSC FUSC_2
Motif
Other DBs
NCBI-ProteinID: AIV76302
UniProt: A0A069BDS2
LinkDB All DBs
Position
2:487474..488547
Genome map
AA seq 357 aa AA seqDB search
MTSTLQSRLPGLVRNALRPVLDPYRRYRHAKLIHAARVALSVLASIALTTGLHVPHGEWA
TITVLIVIGGLQHHGNIRKKAAERALGTLIGAIAGLSLILLQTTVHLSPLTFLVMSVACG
LCAYHAIGKAGYIALLSAITMVIVAGHGDNEIADGLWRAVNVLVGIVIALAFSFALPLYA
TYSWRYKLADALRGCAAVHARIAGERYVSDNERLKDMAALNALLVQLRSLMPSVSKEISV
SMPQLEAIQRSLRLCMSALEILSSRQPGEDDAAGRRFVQIQMKADNRRIQEMLVGAARAL
KFGTPGRLGPLHGPAAAVGENVPPADLSGYVSLTAKLSHEIEQLRQRLRDTAPQWNI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgaccttacaatcccgcctgcccggcctcgtgcgcaatgcgttgcgcccggtg
ctcgatccctatcgccgctaccggcatgcgaagctgatccatgcggcgcgcgtcgcgctg
agcgtgctcgcgtcgatcgcgctgacgaccggcctgcacgttccgcacggcgaatgggcg
acgatcacggtgctgatcgtgatcggcgggctccagcatcacggcaacatccgcaagaag
gccgccgagcgcgcgctcggcacgctgatcggcgcgatcgccggcctctcgctgatcctg
ctgcagaccaccgtgcacctgtcgccgctcacgtttctcgtgatgagcgtcgcgtgcggc
ctctgcgcgtatcacgcgatcggcaaggccggctacatcgcgctgctgtccgcgatcacg
atggtaatcgtcgcgggccacggcgataacgagatcgccgacggcctctggcgcgcggtc
aacgtgctggtcggcatcgtgatcgcgctcgcgttctcgttcgcgctgccgctgtatgcg
acctactcgtggcgctacaagctcgccgatgcgctgcgcggctgcgcggccgtccatgca
cgcatcgcgggcgagcgctacgtgagcgacaacgagcgcctgaaggacatggccgcgctc
aacgcgctgctcgtgcaactgcgttcgctgatgccgtcggtatcgaaggaaatctccgtt
tcgatgccgcagctcgaggcgattcagcggagcctgcggctgtgcatgagcgcgctcgag
atcctgtcgagccggcaacccggcgaggacgacgccgccggcagacgcttcgtccagatc
cagatgaaggcggacaaccggcggatccaggagatgctcgtcggcgcggcgcgcgcgctg
aagttcggcacgccgggccggctcggcccgctgcacgggccggccgcggcggtcggcgag
aacgtgccgcccgcggacttgtccggctatgtctcgctgacggcgaagctctcgcacgag
atcgaacagctcaggcagcgcctgcgcgacaccgcgccgcaatggaatatctga

DBGET integrated database retrieval system