KEGG   Burkholderia pseudomallei TSV202: X994_4129Help
Entry
X994_4129         CDS       T03428                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
but  Burkholderia pseudomallei TSV202
Brite
KEGG Orthology (KO) [BR:but00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    X994_4129 (ahpF)
Enzymes [BR:but01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     X994_4129 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin FAD_oxidored DAO FAD_binding_3 NAD_binding_7 HI0933_like Thi4 AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like Ribosomal_S9
Motif
Other DBs
NCBI-ProteinID: AIV75688
LinkDB All DBs
Position
2:507393..509000
Genome map
AA seq 535 aa AA seqDB search
MLDAHLKTQLKSYLERITRPVELVASLDAGDQSRELRALLDEIAALSPQIFVTERRDAAE
RAPSFSVGEPGKAAGIRFAGMPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRALDGDYA
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTIFLNGET
FGQGRSSVKEILAKLDGGASRRAAQALAEKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDVIDVERADRLVPGRVHE
IRLASGAVLKAKTVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGLAAAVTLIEYGEQLRADDVLQRKLRSLANVTVITQARTTELTGDGAKL
NGLVYEDRRTGEAKRIALEGVFVQIGLVPNTEWLKGTVELSRHGEIVVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDHLIRSEAHAVQAADTEASANAEAMAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcccatctcaagactcagttgaaatcgtacctcgaacggatcacgcgcccc
gtcgagctcgtcgcatcgctcgacgcaggcgaccagtcgcgcgagctgcgcgcgctgctc
gacgagatcgcggcgctgtcgccgcagatcttcgtgaccgagcgccgcgacgcggccgag
cgcgcgccgtcgttctcggtcggcgagccgggcaaggccgcgggcattcgcttcgccggt
atgccgatgggccacgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgcgacgatcgagcagatccgcgcgctcgacggcgactacgca
ttcgagacgtatatctcgctcacctgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggcgcgctgttccag
gacgaagtcgaggcgcgccggatcatggccgtgccgacgatcttcctgaacggcgagacg
ttcggccagggccgcagcagcgtgaaggagatcctcgcgaaactcgacggcggcgcgagc
cggcgcgcggcgcaggcgctcgcggagaaacccgtgttcgacatgctgatcgtcggcggc
ggccccgcgggcgcggcggcggcgatctatgcggcgcgcaagggcatctcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgatacgatggcgatcgagaatttcgtgtcg
gtccaggaaaccgaggggccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gatgtcgacgtgatcgacgtagagcgcgccgaccggctcgtgccgggccgcgttcatgaa
attcgcctcgcgagcggcgcggtgctgaaggcgaagaccgtcgtgctcgcgacgggcgcg
cgctggcgcgagatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacgggccgctcttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggtgtcgaggcggcgatcgatctcgccggccttgccgccgccgtgacgctgatc
gaatacggcgagcagttgcgtgcggacgacgtgctgcaacgcaaactgcgcagcctcgcg
aacgtgacggtgatcacgcaggcacgcacgaccgagctcacgggcgacggcgcgaagctg
aacgggctcgtctacgaggacaggcgcacgggcgaggcgaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggaaccgtcgagctg
tcgaggcacggcgagatcgtcgtcgacgcgcgcggcgcgacatcggtgcccggcgtgttc
gccgccggcgacgtgacgacggtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctcggcgcattcgaccacctgattcgaagcgaggcgcatgccgtgcag
gcggcggataccgaagcttcggcaaacgccgaggccatggccgcctga

DBGET integrated database retrieval system