KEGG   Burkholderia pseudomallei TSV202: X994_440Help
Entry
X994_440          CDS       T03428                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00061  Fatty acid biosynthesis
but00780  Biotin metabolism
but01100  Metabolic pathways
but01212  Fatty acid metabolism
Module
but_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    X994_440 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    X994_440 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:but01004]
    X994_440 (fabZ)
Enzymes [BR:but01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     X994_440 (fabZ)
Lipid biosynthesis proteins [BR:but01004]
 Fatty acid synthase
  Component type
   X994_440 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AIV76945
UniProt: A0A095MC71
LinkDB All DBs
Position
1:509401..509868
Genome map
AA seq 155 aa AA seqDB search
MSTEKINFDIHKILTLLPHRYPILLVDRVLELEPHKAIKALKNVTVNEPFFTGHFPKRPV
MPGVLIIEALAQAAALLTFAEAQPKDPENTLYYFVGIDNARFKRVVEPGDQLILNVTFER
YIRGIWKFKAVAEVDGKVAAEAELMCTVKTADAAP
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaaaaatcaacttcgacattcacaagatcctcacgctgctgccgcaccgc
tatccgattctgctcgtcgatcgcgtgctcgaactcgaaccgcacaaggccatcaaggcg
ctgaagaacgtgacggtcaacgagccgttcttcaccggccacttcccgaagcggccggtg
atgccgggcgtgctgatcatcgaggcgctcgcgcaggcggccgcgctcctcacgttcgcc
gaggcgcagccgaaggatccggagaacacgctgtattacttcgtcggcatcgacaacgcg
cgcttcaagcgcgtcgtcgagccgggcgaccagttgatcctgaacgtgacgttcgagcgc
tatattcgcggcatctggaagttcaaggccgttgcggaagtggacggcaaggtcgcggcg
gaagcggagctgatgtgcacggtcaagacggccgacgcggcgccctga

DBGET integrated database retrieval system