KEGG   Burkholderia pseudomallei TSV202: X994_5901Help
Entry
X994_5901         CDS       T03428                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
but  Burkholderia pseudomallei TSV202
Pathway
but00040  Pentose and glucuronate interconversions
but01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:but00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    X994_5901
Enzymes [BR:but01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     X994_5901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AIV76139
UniProt: A0A2K9DK58
LinkDB All DBs
Position
2:complement(2743919..2744953)
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARELALRDIDLPLEVGPADVKIRVHTVGVCGSDVHYYMHGGIGPFRVHAPMV
LGHEASGTVVEVGRDVTYLRVGERVCMEPGVPRFDSKATLHGLYNLDPSVRFWATPPVHG
CLAPYVVHPAAFTYRLPPNVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFAANRAVTTVDASTQSLADAVAHATDGWGADVVFE
ASGNANAYAGIVDLLCPNGCLVLVGMPLAPVPLDVVSLQAKEARIESVFRYANVFPRALA
LIASGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgagctcgcgctgcgcgacatcgatctgccg
ctcgaggtcggccccgccgacgtcaagatccgcgtccacacggtgggcgtgtgcggcagc
gatgtccattactacatgcacggcggaatcggcccgttccgggtgcacgcgccgatggtg
ctcggccacgaggcgtcgggcacggtcgtcgaggtcgggcgcgacgtcacgtacctgcgc
gtgggcgagcgcgtgtgcatggagcccggcgtgccgcgcttcgattcgaaagcgacgctg
cacggcctgtacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggg
tgcctcgcgccctacgtcgtgcacccggcggcgttcacgtaccggctgccgccgaacgtg
tcgttcgccgagggcgcgatcgtcgagccgctcgcgatcgggctgcaggccgcgaagaag
gcggcgatgaagccgggcgacatcgcggtggtcgtcggcgcgggcacgatcggtgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgatcctcgccgacgtcgtcaag
gaaaagctcgcgctgttcgccgcgaaccgcgcggtgacgacggtcgacgcaagcacgcag
tcgctcgccgatgcggtcgcacacgcgaccgacggctggggcgcggacgtggtgttcgag
gcgagcggcaacgcgaacgcgtatgcgggcatcgtcgatctgctgtgcccgaacggctgc
ctcgtgctggtcggcatgccgctcgcgccggtgccgctcgatgtcgtttcgctgcaggcg
aaggaggcgcgcatcgaatcggtgttccgctacgcgaacgtcttcccgcgcgcgctcgcg
ctgatcgcctccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttctcg
gacggcctgcgcgcattcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system