KEGG   Burkholderia sp. BDU6: WS70_06500
Entry
WS70_06500        CDS       T06044                                 

Definition
(GenBank) hypothetical protein
  KO
K11007  shiga toxin subunit B
Organism
buu  Burkholderia sp. BDU6
Pathway
buu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:buu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    WS70_06500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:buu02042]
    WS70_06500
Bacterial toxins [BR:buu02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    WS70_06500
SSDB
Other DBs
NCBI-ProteinID: AOJ01521
UniProt: A0A1B4FCX3
LinkDB
Position
1:1427147..1427419
AA seq 90 aa
MKKIIAVIASTLLLASSYAHADTLCTSGTINKLFIDKNGVMEVTVGNLSYLNGNKDAYPL
INSAFLMGKQFYIYASTCQPGTSMGGFAVR
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaaaaagattatcgctgttatcgcttcaaccttgcttctggcttcgtcctatgcgcac
gcggatacgttgtgcacgtcgggcacgattaacaagctcttcatcgacaagaacggggtc
atggaggtcaccgtcggcaacctgtcttacttgaacggaaacaaggatgcgtatccgctc
atcaattcggcattcctgatgggtaagcagttctacatttacgcgagcacttgccagccg
ggcacgtcgatgggaggttttgccgttcggtaa

DBGET integrated database retrieval system