KEGG   Burkholderia sp. BDU6: WS70_16715Help
Entry
WS70_16715        CDS       T06044                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
buu  Burkholderia sp. BDU6
Pathway
buu00970  Aminoacyl-tRNA biosynthesis
buu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WS70_16715
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:buu03029]
    WS70_16715
Enzymes [BR:buu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     WS70_16715
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     WS70_16715
Mitochondrial biogenesis [BR:buu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    WS70_16715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase YcaO
Motif
Other DBs
NCBI-ProteinID: AOJ03276
UniProt: A0A1B4FHX4
LinkDB All DBs
Position
1:complement(3742444..3743934)
Genome map
AA seq 496 aa AA seqDB search
MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDADLTLAQAKAADAALA
QGAAGPLAGLPIAHKDVFVTRGWRSTAGSKMLANYTSPFDATVVARLAKAGMVTLGKTNM
DEFAMGSSNENSAFGPVKNPWDTNAVPGGSSGGSSAAVAARLAPAATGTDTGGSIRQPAS
FAGVTGIKPTYGRVSRYGMIAFASSLDQGGPIARSAADCALLLNAMAGFDERDSTSLERA
DEDYTRHLGKTWSADADAGKPLAGLRIGLPSEYFGAGLADDVRAAIDAALKQYEALGATL
VPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAAEYRDLLDMYKKSRAEGFGPE
VKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFKQCDVIMGPASPTVAWDLGAK
GDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAKRPVGLQIIGNYFDEARMLQVAD
AFQRATDWHEQKPAGV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaaaagcctgaccgaactgcgcgccgcgctcgatgccaaggaatgctcggcc
gtcgagcttgcgcagcactatttgaaacggatcgacgccgcgcgcgatctgaacgcgttc
gtccacgtcgacgcggatctcacgctcgcgcaggcgaaggcggccgacgccgcgctcgcg
caaggcgccgccggcccgctcgccggcctgccgatcgcccacaaggacgtattcgtcacg
cgcggctggcgctcgaccgccggctcgaagatgctcgcgaactacacgagcccgttcgac
gcgaccgtcgtcgcgcgcctcgcgaaggcgggcatggtcacgctcggcaagaccaacatg
gacgagttcgcgatgggctcgtcgaacgagaactccgcgttcggcccggtgaagaaccct
tgggacacgaacgcggtgccgggcggcagctcgggcggcagctcggctgcggtcgccgcg
cgcctcgcgcccgccgcgaccggcaccgacaccggcggctcgatccgccagccggcgtcg
ttcgccggcgtgacgggcatcaagccgacgtacggccgcgtgtcgcgctacgggatgatc
gcgttcgcgtcgtcgctcgaccagggcggcccgatcgcgcggagcgccgccgactgcgcg
ctcctgctgaacgcgatggcgggcttcgacgagcgcgactcgacgagcctcgagcgcgcc
gatgaggactatacgcgccacctcggcaagacgtggtcggccgacgccgacgcgggcaag
ccgctcgccggcctgcgcatcggcttgccgagcgaatacttcggcgcgggtctcgccgac
gacgtgcgcgccgcgatcgacgccgcgctcaagcagtacgaagcgctcggcgcgacgctc
gtgccggtgtcgctgccgaagaccgagctgtcgatccccgtttattacgtgatcgcaccg
gcggaagcgtcgtcgaacctgtcgcgtttcgacggcgtgcgctacggccaccgcgcggcc
gagtaccgcgatctgctcgacatgtacaagaagtcgcgcgccgagggcttcgggccggaa
gtgaagcgccggattctcgtcggcacgtacgtgctgtcgcacggctattacgatgcgtat
tacctgcaggcgcagaagatccgccggatcatcgcgcaggatttccaggaggcgttcaag
cagtgcgacgtgatcatgggtccggcgtcgccgaccgtcgcgtgggacctcggcgcgaag
ggcgacgatcccgtccagatgtacctcgcggacatctacacgctgtcggtgagcctcgcc
ggcctgcccggcatgagcgtgccgtgcggcttcggcgcgggcgcgaatgcaaagcgcccg
gtcggtctgcagatcatcggcaactatttcgacgaagccaggatgctgcaggtcgccgac
gcgttccagcgcgcgaccgactggcacgaacagaaaccggcaggagtgtga

DBGET integrated database retrieval system