KEGG   Burkholderia sp. BDU6: WS70_19865Help
Entry
WS70_19865        CDS       T06044                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
buu  Burkholderia sp. BDU6
Brite
KEGG Orthology (KO) [BR:buu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WS70_19865
Enzymes [BR:buu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     WS70_19865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin DAO HI0933_like FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AOJ04133
UniProt: A0A1B4FKE1
LinkDB All DBs
Position
2:complement(668605..670212)
Genome map
AA seq 535 aa AA seqDB search
MLDTNLKTQLKSYLERITRPVELVASLDNGDKSRELHALLDEIASLSPQVTVVERRDDAE
RKPSFSVGERGKATGIRFAGIPMGHEFTSLVLALLQAGGHPLKLDDAVIEQIRQLDGDYA
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTLFLNGET
FGQGRSSVKEILAKLDAGASRRAAEALAAKPVFDMLIVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYEVDVIDVQRADKLVPGRIHE
IHLASGAVLKAKAIVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGVVREVTLIEYGTQLRADEVLQRKLHSLANVTVITQARTTELTGDGAKL
NGLVYEDMRAGETKRVELEGVFVQIGLVPNTEWLKGTLALSKHGEITVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDYLIRSEADAAPAPATEAAQSDERVAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaatctcaagactcagttgaaatcgtacctcgaacgaatcacccgcccg
gtcgagctcgtcgcgtcactcgacaacggcgacaagtcgcgcgagctgcacgcgctgctc
gacgagatcgcgtcgctgtcgccgcaagtcaccgtggtcgagcgccgcgacgacgccgag
cgcaagccgtcgttctcggtcggcgaacggggcaaggcgaccggcattcgtttcgccggc
attccgatgggccatgaattcacgtcgctcgtgctcgcactgctgcaagcgggcggtcat
ccgctcaagctcgacgacgcggtgatcgagcagatccgccagctcgacggcgactacgca
ttcgagacgtacatttcgctgacctgccagaactgcccggaagtcgtacaggcgctcaat
gtgatggcgctcgtcaacccgcgcatccgtcacgtgatgatcgacggcgcgctgttccag
gacgaggtcgaagcgcgccggatcatggccgtgccgacgctctttctgaacggcgaaacc
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatgccggcgcgagc
cggcgcgcggcggaggcgctcgcggcgaagcctgtgttcgacatgctgatcgtcggcggc
ggccccgcgggcgcggcggctgcgatctacgcggcgcgcaagggcattgcgacgggcgtc
gtcgccgagcgcttcggcgggcaggtgctcgacacgatggccatcgagaacttcgtgtcg
gtccaggaaaccgaggggccgaagttcgcgaccgcgctcgaacaacacgtaaagcagtac
gaagtcgacgtgatcgacgtgcagcgcgccgacaagctcgtccccggccgtattcacgag
atccatctcgcgagcggcgcggtgctgaaggcgaaggccatcgtgctcgcgaccggcgcg
cgctggcgcgaaatcggcgtgcccggcgagcgcgagtatcgcaatcgcggtgtcgcgtac
tgcccgcattgcgacggcccgctcttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggtgtcgaagcggcgatcgatctcgccggcgtcgtccgcgaggtgacgctgatc
gaatacggcacacagctgcgcgcggacgaagtgctgcagcgcaagctgcacagtctcgcg
aacgtgacggtgatcacgcaggcacgcacgaccgaactcacgggcgacggcgcgaagctg
aacgggctcgtctacgaagacatgcgcgccggcgagacgaagcgcgtcgagctggaaggc
gtgttcgtccagatcggcctcgtgccgaacaccgaatggctgaagggaacgctcgctctg
tcgaagcacggcgagatcaccgtcgatgcgcgcggcgcaacgtcggtgccgggcgtgttc
gcagccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgccgtcggtgaaggc
gcgaaggcttcgctcggcgcgttcgattacctgatccgcagcgaagcggacgcggcgccg
gccccggccaccgaagccgcgcaaagcgacgagcgggtcgctgcctga

DBGET integrated database retrieval system