KEGG   Burkholderia sp. BDU6: WS70_20055
Entry
WS70_20055        CDS       T06044                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
buu  Burkholderia sp. BDU6
Pathway
buu00440  Phosphonate and phosphinate metabolism
buu00998  Biosynthesis of various secondary metabolites - part 2
buu01100  Metabolic pathways
buu01110  Biosynthesis of secondary metabolites
buu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WS70_20055
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    WS70_20055
Enzymes [BR:buu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WS70_20055
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD
Other DBs
NCBI-ProteinID: AOJ04160
UniProt: A0A1B4FKF4
LinkDB
Position
2:complement(719037..720725)
AA seq 562 aa
MNAREPNFTESRSARLRRMLTSNELEFLMEAHNGLSARIVRETGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEVDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAALVLAASRGAGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAETGELASLACAAERLSGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNRSVRDFALCSAADDRGLFGQKALLRRVSSDAGEGEPHGRWIGLLNV
RGAGVARLKAMLDALKARDDFDSLDLPALLNALVDAGEKIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNTVNGGAR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcgacggatgctg
acgagcaacgagctcgaattcctgatggaggcgcacaacggcctgtccgcgcggatcgtc
cgcgagacgggcttcaaggggatctgggcgtcgggactcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtccgccgtctcgtgaaaaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgaggtc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgccgaggcgggcgcggacgcgatcctgatccacagcaagctgtcgcgt
cccgacgaaatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtcatcgtg
ccgaccaagtattacagcacgcccaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtccgcgtccgcgatgcaagcggtcgcccgagaa
attcaggacagcgagacgctcgtcaacgtcgaggagcgcgtcgcgagcgtcaacgagatc
ttccgcctgcaggatgccgacgaatactcagccgccgagcggatctacctgtcgtcgagc
tcgcgcgcgtcgaacgccgcgctcgtgctcgcggcgagccgcggcgcggggctcgaggcc
gtcaccgaagacaagccgaaggtgatgctgccggtcgccggcaagccgctcttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctatcgc
gccgacgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcggaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgagcgcctctcgggcgacaccgtgatctcg
tacggcgacctgctgtttcgcagctacatcctgcgcgatctcgccgagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccggagcgtgcgcgacttc
gcgttgtgctcggccgccgacgaccgcgggctgttcggccagaaggccctgctgcgccgc
gtgtcgagcgatgcgggcgaaggcgagccgcacggccgctggatcggtctcctcaacgta
cgcggcgcgggcgtcgcgcggctcaaggcgatgctcgacgcgctgaaggcccgtgacgat
ttcgattcgctcgatctgccggcgctcctgaacgcgctcgtcgacgcgggcgagaagatc
gaggtgcaatacgtgcacggccactggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggaacagaacacggtcaacggaggc
gcgagatga

DBGET integrated database retrieval system