KEGG   Burkholderia sp. BDU6: WS70_20075Help
Entry
WS70_20075        CDS       T06044                                 

Definition
(GenBank) CDP-alcohol phosphatidyltransferase
Organism
buu  Burkholderia sp. BDU6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: AOJ04164
UniProt: A0A1B4FKJ0
LinkDB All DBs
Position
2:complement(723305..723994)
Genome map
AA seq 229 aa AA seqDB search
MDQRKSTANRVASPPPRTWDARLARRLVTPLVGTPVTPNHLTTLRLLIGLAGAWCLAQPG
FGWINAGAFLIVLSNFVDHTDGELARISGQSSKLGHFYDLASDALVTVALFVSMGVGVVA
AGGQMAASPVLLGAVAGAAVALIFFLRMRIESFAGKAGTKQAFAGGFETEDVLYLLPVVT
LLDGVEPFLLAAAIGAPLFAAWVVIDYWRIARRGNASRALNSTEIQPTK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaagaaaatccaccgccaaccgtgttgcgagcccgccgccccgcacctgggat
gcacggctcgcacgccggctcgttacgccgctcgtcggcacaccggtcacgcccaaccac
ctgaccacgctgcgtcttttgatcggcctcgccggcgcttggtgcctcgcgcaacccggc
ttcggctggatcaacgcgggggcgttcctgatcgtgctgtccaatttcgtcgatcacacc
gacggcgaactcgcccgaatcagcggccagtcgagcaagctcggccacttctacgacctc
gcgagcgacgcgctcgtcacggtcgccctcttcgtcagcatgggcgtcggcgtcgtcgcg
gcgggcggccagatggccgcgtcgcccgtgctgctcggtgccgtcgcgggcgcggccgtc
gcgctgatcttcttcctgcggatgcggatcgagtcgttcgccggcaaggcaggcacgaag
caggcgttcgccggcggcttcgagaccgaggacgtcctgtatctgctgcccgtcgtcacg
ctgctcgacggcgtcgagccgttcctcctcgcggcggcgatcggcgcgccgctcttcgcg
gcgtgggtcgtgatcgactactggcgcatcgcgcgccgcggcaacgcgtcccgcgcgctc
aattcaaccgaaatccaaccaaccaaatga

DBGET integrated database retrieval system