KEGG   Burkholderia sp. BDU6: WS70_21425
Entry
WS70_21425        CDS       T06044                                 

Definition
(GenBank) EvpB family type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
buu  Burkholderia sp. BDU6
Brite
KEGG Orthology (KO) [BR:buu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:buu02044]
    WS70_21425
Secretion system [BR:buu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   WS70_21425
SSDB
Motif
Pfam: VipB VipB_2 DUF3258
Other DBs
NCBI-ProteinID: AOJ04401
UniProt: A0A1B4FL39
LinkDB
Position
2:complement(1045504..1046997)
AA seq 497 aa
MKKPQTQTPVAEAQPASDFARLLTHEFKPKTEQAREAVEYAVRTLAEQALQQSAKISDDA
YKSIAAIIAQIDHKLSEQINLILHHEDFQKIESAWRGLHHMVSNTETDERLKIRFIDISK
EELRRTMRRYKGLAWDQSPLFKQIYEEEYGQLGGEPYGCLMADYYFDHTPPDVDLLGSIA
KVAASAHTPFISGASPSVLQMESWQELANPRDLTKIFTQNLEYASWNSLRNTDDARYIGL
AMPRFLSRLPYGVQTNPVDEFDFEEDTNGADHRRYAWTNAAYAMGVNINRSFRQYGWCSL
IRGVESGGTVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIPLVHRKNTGHA
TFIGAQSLHKPAEYDDADATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKEREDMQ
RWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEEAEGNPGYYKAKFFLRPHFQLEGL
TVSLRLVAKLPSIKEAA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaaaaaaccgcaaacgcagacgcctgtcgccgaagcgcaaccggcatcggacttcgcg
cgtctactcacgcacgagttcaagccgaagaccgaacaggcccgcgaagccgtcgagtac
gcagtccgcacgctcgccgaacaggcgctgcagcagtccgccaagatcagcgacgatgcc
tacaagagcatcgccgccatcatcgcgcagatcgatcacaagctctccgagcagatcaat
ctgatcctccatcacgaggattttcagaagatcgagtcggcgtggcgcggattgcaccac
atggtgtcgaacaccgaaaccgacgagcgcctgaagatccgcttcatcgacatctcgaaa
gaagagctgcgccgcaccatgcgacgctacaagggcctggcgtgggaccagagcccgctc
ttcaagcagatctacgaagaggaatacggccagctcggcggcgagccgtacggctgcctg
atggccgattactacttcgaccacacgccgccggacgtcgacctgctcggctcgatcgcg
aaggtggccgcgtccgcgcacacgccgttcatttccggcgcgtcgccgtcggtgctgcag
atggaatcgtggcaggagctcgcgaatccgcgcgatctcacgaagatcttcacgcagaac
ctcgaatacgcgtcgtggaattcgctgcgcaacacggacgatgcgcgctacatcggcctc
gcgatgccgcgcttcctgtcgcgcctgccgtacggcgtgcagaccaatccggtcgacgag
ttcgatttcgaggaagacacgaacggcgccgatcaccgccgctatgcgtggacgaacgcc
gcctatgcgatgggcgtgaacatcaaccggtcgttcaggcagtacggctggtgctcgctg
atccgcggcgtcgagtccggcggcacggtcgagaacctgccgtgccacacgttcccgacc
gacgacggcggcgtcgacatgaaatgcccgaccgagatcgcgatttccgaccgtcgcgag
gccgagctctcgaagaacggcttcattccgctcgttcaccgcaagaacaccggccatgcg
accttcatcggcgcgcagtcgctgcacaagccggctgaatacgacgatgccgacgcaacc
gccaacgccaacctgtcggcgcgcctgccctatctcttcgcgtgctcgcgcttcgcgcac
tacctgaagtgcatcgtgcgcgacaaggtcggcgcgttcaaggagcgtgaggacatgcag
cgctggctgaacgaatggatcatgaactacgtcgatgcggacccggcgaactcgtcgcag
gacacgaaggcgcgccgaccgctcgcggccgccgaagtggtcgtcgaggaagcggaaggc
aaccccggctactacaaggcgaaattcttcctgcggccgcacttccagctcgaaggcctg
accgtgtcgctgcggctggttgcgaagctgccgtcgatcaaggaagccgcctga

DBGET integrated database retrieval system