KEGG   Butyricimonas sp. H184: D8S85_10440Help
Entry
D8S85_10440       CDS       T05785                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
buy  Butyricimonas sp. H184
Pathway
buy00564  Glycerophospholipid metabolism
buy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D8S85_10440
Enzymes [BR:buy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D8S85_10440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Lycopene_cycl FAD_oxidored GMC_oxred_N Pyr_redox_2 Pyr_redox FAD_binding_3 NAD_binding_8 HI0933_like GIDA Pyr_redox_3 3HCDH_N PXT1
Motif
Other DBs
NCBI-ProteinID: AZS29925
LinkDB All DBs
Position
complement(2357442..2359019)
Genome map
AA seq 525 aa AA seqDB search
MNRRDMLSKLQEPEKVWDMVVVGGGATGLGVAVDAATRGYSVVLLEMVDFAKSTSSRSTK
LVHGGVRYLQKGDVALVLEALRERGRMKANAPHLVKDQAFVISNYTYWDNFLYFCGLTLY
DLLSFGFGYGRSRFISSRKVMEYLPTSVKKGLKGGIVYHDGQFDDSRMAINLAQTCADNG
GVILNKAKVSGIVHDQNGKVAGVKFVDVESGKEMQLKAKSVINACGILVDDLMAMDSPGH
SKMVTPSQGVHLVLDMKFLQSDYAIMVPKTSDGRVLFAVPWHNKVVVGTTDIMRPVPEIE
PKPLKEEIDFILKTASLYMDPAPTYADIESVFAGQRPLAAPKHEGKSTKELSRGHKIIVS
DNDLITITGGKWTSYRLMAEDTVNKAIAMKLLDDRPCVTKKFHIHGYRKNPNLKNHMYVY
GSDQDAIMKLMAENPEYGKKLSDKYDYTVAEVVWAVREEMAQEVEDVLARRVRLLFVDAR
EAMKAAPLVAEVMAKELGKDQAWIDEEVKEFTELAENYIAAKIMF
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaagagatatgttgagtaaacttcaggaacctgagaaagtatgggatatggtt
gtggttggaggcggagctacggggttgggggtggctgttgatgctgcaacaagaggatac
agtgttgtccttttggaaatggtcgattttgccaagagtacctcaagccggagtacaaaa
ttggtacacggcggtgtgcgctatcttcaaaaaggagatgtcgctttggtgttagaggcg
ttaagggagagagggcgaatgaaagcgaatgctccacatctcgtgaaggatcaagctttt
gtaatatcaaattatacgtattgggataattttctgtatttctgcggacttacactttat
gacctgttatcttttggcttcgggtacggcagaagtcgttttatttcttccaggaaggtg
atggagtatttaccgacatcggtgaagaaagggttgaaagggggaatcgtttatcatgac
gggcagtttgatgattcgcggatggcgattaatttggctcaaacttgtgcggataatggt
ggggtaatactcaataaagcgaaggtctccgggattgtgcatgaccagaacgggaaagtt
gccggggtaaagttcgtggatgtggagtctggaaaagagatgcagttgaaggcgaagagc
gtgatcaatgcctgtggtattctggtggatgacctgatggcgatggattccccggggcat
agcaagatggtgacgccgagtcaaggagtgcatctggtgttggatatgaagtttttgcag
agcgattacgcgattatggttccgaagacgagtgacggacgagtactttttgctgtgcct
tggcacaataaggtcgtcgtggggacgacggatattatgcgtccggttccggaaattgag
ccgaaaccgttgaaggaggagattgattttattctgaagacggcttctttatacatggat
ccggccccgacgtatgccgatattgaatccgtgtttgcagggcaacgaccgttggcagcc
ccgaaacacgagggaaagagtacgaaagagctttcccgtgggcataagattatagtttcc
gataatgatttaatcacgatcacgggaggtaaatggacttcatatcgtttgatggcagag
gatacggtgaataaggcgattgccatgaaattgctggatgacagaccttgtgtgacgaag
aaattccatatacacgggtaccggaagaatccgaatctgaaaaatcacatgtacgtttat
ggtagtgatcaagacgcgattatgaagttgatggctgaaaacccggaatatgggaagaag
ttgtcagataaatatgattataccgttgctgaggttgtttgggcagttcgggaggagatg
gcccaagaggttgaggatgttcttgcccggagggttcgattgttgtttgtcgatgcgaga
gaggcgatgaaggctgccccgctggtggcagaagtgatggcgaaagaacttgggaaagat
caggcatggattgatgaagaagtgaaggagttcaccgaattggcagaaaattacatcgct
gctaagatcatgttttga

DBGET integrated database retrieval system