KEGG   Butyricimonas sp. H184: D8S85_17830Help
Entry
D8S85_17830       CDS       T05785                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
buy  Butyricimonas sp. H184
Brite
KEGG Orthology (KO) [BR:buy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D8S85_17830 (ahpF)
Enzymes [BR:buy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D8S85_17830 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored DAO Thi4 AlaDh_PNT_C NAD_binding_8 Glutaredoxin PDH_E1_M Nif11 K_oxygenase Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AZS31232
UniProt: A0A3S9VXG7
LinkDB All DBs
Position
complement(4140113..4141663)
Genome map
AA seq 516 aa AA seqDB search
MLDISLKDQLKNIFAVLEAQYTLDIAVAPQHESRQELTEMLADVAECTDKISCRIREGKE
LEFALLKNGEPTGIKFRGVPNGHEFTSLLLAIMNADGKGKNFPDETICNRVKALKGPIHL
TTYVSLTCTNCPDVVQALNAMATLNPQIHHEMVDGAIYQDEVEELKIQGVPSVFADGKLI
HVGRGEFGELLNKLEAQYGIQENTLETKEKSYDVIVLGGGPAGSAAAIYSARKGLNVAVI
AERIGGQVKETVGIENLISVPETTGNQLADNLRTHLQCYPIDLLEHRRIEKIELKDKQKE
LSTATGEKFSAPAVIVATGASWRKLNVPGEAEYIGRGVAFCPHCDGPFYKGKHVAVVGGG
NSGIEAAIDLAGICSKVTVLEFLDHLKADQVLQEKLKSLPNVEVFVSSQTLEVIGNGDKV
TGIRVKNRATEEARTIELDGIFVQIGLMPNSGVFREVVDTNRMGEIAIDTHCRTNIPGIY
AAGDVSTVPYKQIIIAMGEGAKAALSAFEDRMRGAI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctagatatctctttaaaagatcaacttaaaaacattttcgctgttttagaggcacaa
tacacgttggacatcgccgtagctcctcaacacgaaagtcgtcaggaattaacagagatg
ttggctgacgtggctgaatgtacggataaaatttcttgccggattagagagggaaaggaa
ttagagtttgctttactgaaaaacggagagcccacaggtatcaaattccggggtgttccc
aatgggcacgagttcacctctcttctgcttgccatcatgaatgcagacgggaaaggaaag
aattttccggacgagaccatttgtaaccgggtaaaagcattgaaaggcccgattcacttg
acaacctacgtatctttaacttgtaccaactgtccggatgtcgtgcaggcattaaatgcc
atggctacattaaatccacaaatccaccacgaaatggttgacggggccatctatcaggat
gaagtagaagaattaaagatacagggtgtaccttccgtgtttgctgatggaaaacttatt
catgtcggaagaggagaattcggtgaattattaaacaaacttgaggcacaatacgggatc
caagaaaacacgctggagacgaaagaaaaaagttatgatgtcatcgttctaggaggaggc
ccagcgggttcggcagccgccatttactctgcacgaaaaggattgaacgtggcagttata
gcggaacgcatcgggggacaagtcaaagaaacggtgggaattgaaaacctgatctctgtc
ccggaaacaacaggaaatcaattggcagataatttacggacacatttacaatgttacccg
attgacttgttagaacatcggcgaatcgaaaaaatagaattaaaggacaaacaaaaagaa
ctttccacggctaccggggagaaattctccgcaccggcagttatcgtggctaccggagcc
agttggagaaaactgaacgtaccgggagaggcagagtatatcggcagaggtgtcgcgttc
tgcccacattgcgacggaccgttctacaaaggcaaacacgttgctgttgtaggaggagga
aactcagggatagaggctgccattgatttggcaggaatatgttcaaaagttaccgtattg
gaattcctggaccatttaaaggccgaccaagtgttgcaagaaaaactaaagagtctaccc
aacgtggaagtctttgtcagttcacaaactcttgaagttatcggcaacggggataaggta
acaggtattcgggtaaaaaatcgggcaaccgaagaggctcgcaccatcgaattggacgga
attttcgttcagatcgggctaatgcccaatagcggtgttttccgggaagtggtcgacacg
aatcgaatgggagaaattgctattgacacgcattgccgtacgaatattccgggaatctat
gccgcgggagatgtctccacagtcccctacaaacaaatcatcatcgccatgggagaagga
gcaaaagcagccctttcggcctttgaggaccggatgcgaggagctatttga

DBGET integrated database retrieval system