KEGG   Burkholderia sp. OLGA172: AYM40_00175Help
Entry
AYM40_00175       CDS       T05111                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00010  Glycolysis / Gluconeogenesis
buz00620  Pyruvate metabolism
buz01100  Metabolic pathways
buz01110  Biosynthesis of secondary metabolites
buz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYM40_00175
   00620 Pyruvate metabolism
    AYM40_00175
Enzymes [BR:buz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AYM40_00175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ANB70940
UniProt: A0A167VML2
LinkDB All DBs
Position
1:complement(40525..42045)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLTTEFPYKKQYANFIGGEWVKPVGGEYFDNVSPITGEPFTSIPRSREADIEL
ALDAAHRAKAAWGKTSTTDRANILNRIADRMEANLQRIAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLLELIHDLLPPGVLNVVNGFGLEAGKPLASSKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMNKDDSYFDKALEGFTMFALNQGEV
CTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDTKTMIGAQASQEQLEKILSYVDLGK
QEGAECLIGGERNKLDGELSKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKNEDEAL
EIANDTLYGLGAGVWTRDGTRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNMLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgcagtttctgacgaccgaattcccgtacaaaaagcagtatgcg
aattttatcggcggcgaatgggtcaagcctgtgggtggtgagtacttcgacaacgtatcg
ccgatcactggcgagccgttcacctcgatcccgcgttcgcgcgaagccgatatcgaactc
gcactcgacgccgcgcatcgtgcgaaggcagcgtggggcaagacctcgaccaccgatcgc
gcgaacattctgaaccgtatcgccgaccggatggaagcgaatctgcaacgcatcgccgtg
gctgaaacgatcgacaacggcaagccgctacgcgaaacgatggctgcggatatcccgctc
gccatcgatcatttccgctatttcgccggcgccgtgcgtgcgcaggaaggctcgatctcc
gagatcgaccacgacacagtcgcgtatcactttcacgagccgctcggcgtggtcggccag
atcattccgtggaatttcccgatcctgatggcggtatggaagctcgcgcctgcgttggct
gccggcaattgcgtcgtgctgaagccagctgagcaaacgcctgcgtcgattctcgtgctg
ctcgaactgatccacgatttgctgccgccgggcgtgctgaacgtagtgaacggtttcggc
ctcgaagccggcaaaccgctcgcgtcgagcaagcgcatcgcaaagatcgctttcacgggc
gagacaacaaccggccgcctgatcatgcagtacgcgagccagaacatcattccggtgacg
ctcgaactcggcggcaagagcccgaacattttctttgccgacgtgatgaacaaggacgac
agctatttcgacaaggcgctggaaggcttcacgatgttcgcgctgaatcagggcgaagtg
tgcacgtgtccgtcgcgtgtgctgatcgatgaaaagatttacgaccgcttcatggagcgc
gcattgaagcgtgtggctgcgattacgcaaggccatccgctcgatacgaagacgatgatc
ggcgcgcaggcctcgcaggaacagctggaaaaaatcctctcgtacgtcgacctcggcaag
caggagggtgctgagtgtctgatcggcggcgagcgcaataaactcgacggcgaactgagc
aagggctactacgtgaagccgaccgtattccgcggccacaacaagatgcgcatcttccag
gaagaaatcttcgggccggtcgtttccgtgacgaccttcaagaacgaagatgaagcgctc
gagatcgccaacgatacgctctacggtctgggcgccggtgtgtggacgcgcgacggcacg
cgcgcctatcgcttcggccgggaaatccaggcgggccgcgtgtggaccaactgctatcac
gcgtatccggcacatgctgcgttcggcggctacaagcaatcgggcatcggccgggaaaat
cacaagatgatgctcgaccactatcagcagaccaagaacatgctcgtcagctatagcgat
aagccgctcggcttcttctaa

DBGET integrated database retrieval system