KEGG   Burkholderia sp. OLGA172: AYM40_04060Help
Entry
AYM40_04060       CDS       T05111                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00620  Pyruvate metabolism
buz00680  Methane metabolism
buz00710  Carbon fixation in photosynthetic organisms
buz01100  Metabolic pathways
buz01120  Microbial metabolism in diverse environments
buz01200  Carbon metabolism
Module
buz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYM40_04060
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AYM40_04060
   00680 Methane metabolism
    AYM40_04060
Enzymes [BR:buz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AYM40_04060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANB71635
UniProt: A0A160FHS1
LinkDB All DBs
Position
1:complement(954615..957815)
Genome map
AA seq 1066 aa AA seqDB search
MTSSGSARPARRNTASPNAQAADAASASAATAAPSTPAKRAGKAAQASQAANVAKAAKAS
APAKTDKTAKAVKTNKATHAANAANALKPAKARSPKLKADANEAAQQAADAPTLQAVSLD
TIVPASKSSGRSRDDKDHPLFQDIRYLGRLLGDVLREQEGDAVFDVVETIRQTAVRFRRE
DDNAAAQTLDKKLRSLSPEQTVSVVRAFSYFSHLANIAEDRHRNRRHRIHALAGSTSQPG
TIAHALERLVEAGAAATPVLQQFFNEALIVPVLTAHPTEVQRKSILDAQHDVARLLAERD
QPLTNRERARNEAMLRASVTSLWQTRMLRDSRLTVADEIENALSYYRATFLEEIPALYAD
IEEALAEHGLAARLPPFFQMGSWIGGDRDGNPNVTAETLEHAITRQAAVIFEHYMEQVHK
LGAELSVSNLLAGASDALKELAAASPDQSPHRTDEPYRRALIGMYTRLAASARVRLGEGS
VPVRSAGRGAAPVRAKPYDNAAEFVRDLHVLIDSLAEHHGAPLAAPRLSPLARAAEVFGF
HLASIDLRQSSDIHEAVIAELLKRAGVEDDYASLSEEDKLKVLLAELSQPRPLRLPYAEY
SDLVKSELGVLEEARVTREKFGARAVRNYIISHTETVSDLVEVMLLQKETGLLHGRLGDA
HDPAQAGLMVIPLFETIPDLRNAPHIMRDLIALPGVDALIEHQGNEQEVMLGYSDSNKDG
GFLTSNWELYRAELALVSLFNERGVTLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQI
RLTEQGEVIASKFGNPEIGRRNLETVVAATLEASLLPHGNAPAQLPAFEETMQQLSDAAM
ASYRALVYETPGFKEYFFESTPISEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSW
GQCRLLLTGWYGFGSAVAAHLDSAPSDAERIRRLALLKKMHKTWPFFSNLLSNMDMVLAK
TDLAVASRYAQLVSDKKLRKHVFERIVAEWERTSKVLSEITGKSERLAENPLLARSIKNR
FPYLDPLNHLQVELLKRHRAGDTNARVRRGIHLSINGIAAGLRNTG
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgccctgcccgccgcaacactgcatcgcccaacgctcaa
gcggcggacgccgcttctgcctccgccgcaacggctgccccatccacaccggccaaacgc
gccggcaaagcagcccaggcaagccaggccgctaacgtcgccaaagccgccaaagcctcc
gcgcccgcgaagaccgacaagacggcgaaggccgtcaagacaaacaaggcgacgcacgcc
gcgaacgccgccaacgcgctgaaaccggccaaagccaggtccccgaagctcaaggccgat
gcaaacgaagccgcgcagcaggccgctgacgcgcccacgctgcaggcggtttcgctggat
acgatcgtgcccgcgtcgaaaagcagcggccgctcgcgcgacgacaaggatcatccgcta
ttccaggacatccgatatctgggacgcctgctcggcgacgtgctgcgcgaacaggaaggc
gacgcggtgttcgacgtcgtggagacgatccgccagaccgccgtgcgttttcgccgtgag
gacgacaacgccgccgcccagacgctcgacaagaaactgcgttcgctgagccccgagcaa
acggtcagcgtggtgcgtgcgttcagctacttctcgcatcttgcgaatatcgctgaagac
cgccaccgcaatcgccgtcaccggattcacgcgctggccggctcgacctcgcaaccgggc
accatcgcgcatgcgctcgaacggctcgtcgaggcgggcgccgccgcgacgccggtcctg
cagcagttcttcaacgaagcgttgatcgtgccggtcctgaccgcgcaccctacggaagtg
cagcgcaagagcattctcgacgcgcagcacgacgtcgcgcgcctgctcgccgaacgcgat
cagccgttgaccaaccgcgaacgcgcgcgtaacgaagcgatgctgcgtgccagcgtcacg
tcgctgtggcaaacgcggatgctgcgcgactcgcgcctgacggttgccgatgaaatcgaa
aacgcgctgtcgtattaccgcgccactttcctcgaagaaattccggcgctctacgccgac
atcgaagaagcgctcgccgagcacggcctcgctgcacgcctgccgccgttcttccagatg
ggcagctggatcggcggcgatcgcgacggcaatccgaacgtcacggccgaaacgctcgag
cacgcgatcacccgccaggctgcggtgatcttcgaacactatatggagcaggtgcacaag
ctgggcgccgagttgtcggtgtcgaatctgctggccggcgcaagcgacgcattgaaagaa
ctcgcagccgcctcgcccgaccagtccccacaccgtaccgacgaaccgtatcgccgcgcc
ttgatcggcatgtacacccggctcgcggccagtgcgcgcgtgcgtctcggcgaaggcagc
gtgccggtgcgcagcgcgggccgcggcgcggcgccggtgcgtgccaaaccgtatgacaac
gccgccgaattcgtgcgcgacctgcacgtgctgatcgattcgctcgccgagcatcatggc
gcgccgctcgcggcaccccgcctgtcgccgctcgcgcgcgccgccgaagtgttcggcttc
catctggcgagcatcgacttgcgccagagctccgacatccatgaagcggtgatcgccgag
ttgctgaaacgcgcaggcgtcgaagacgactatgcgtcgctctcagaagaagacaagctc
aaggtgctgctcgccgaactgtcgcagccgcgcccgttgcgcctgccctacgccgagtac
tccgatctcgtgaagagcgaactcggcgtgctcgaagaggcccgcgtcacgcgcgagaag
ttcggcgcgcgcgcggtgcgcaactacatcatttcgcacacggagaccgtcagcgatctg
gtcgaagtgatgttgctgcaaaaggaaaccggcctgctgcacggccgtctgggcgacgcg
cacgatcccgcgcaagccgggctgatggtgatcccgttgttcgagacgatccccgacttg
cgcaacgcgccgcatatcatgcgcgatttgatcgcgctaccgggcgtggatgccttgatc
gaacatcagggcaacgagcaggaagtgatgctcggctattcggacagcaacaaggacggc
ggcttcctgacgtcgaactgggagctgtaccgcgccgaactggcgctggtgtcgctgttc
aatgagcgcggcgtgaccctgcgcctgttccatggacgcggaggcacggttggccgtggc
ggtggcccgacgtatcaggcgattctgtcgcagccgccgggcaccgtcgacggccagatc
cgtttgaccgagcaaggcgaagtgatcgccagcaagttcggcaacccggaaatcggccgg
cgcaatctggaaaccgtggtggccgcgacgctcgaagcctcgttgttgccgcacggcaat
gcgcccgcgcaactgcccgccttcgaagaaacgatgcagcaattgtccgacgcggcaatg
gcgtcgtatcgcgcgctggtctacgaaacgccgggcttcaaggagtatttcttcgagtcg
acgccgatttccgaaatcgccgagctgaacatcggcagccgtccggcttcgcgcaaattg
caggacccgaagcaacgcaagatcgaagatctgcgcgcgattccgtggggcttctcatgg
ggtcaatgccgcttgctgctgaccggctggtacggtttcggcagcgccgtggccgcgcat
ctggacagcgcgccgagcgacgccgagcgcatccgccgtctggcgctgctcaagaagatg
cacaagacctggccgttcttctcgaacctgctctccaacatggacatggtgctggcgaag
accgacctcgcggtggcctcgcgctacgcacagctcgtgtcggacaagaagctgcgcaag
cacgtattcgagcggatcgtcgcggaatgggagcgtacgtcgaaggtattgtcggagatc
accggcaagagcgaacggctcgcggagaacccgctgctcgcgcggtcgatcaagaaccgc
ttcccgtatctcgacccgctcaatcacttgcaagtggagttgctcaagcgccaccgcgcg
ggcgataccaacgcgcgcgtgcggcgcgggattcatttgagcatcaacgggattgcggcg
ggcctgcgtaatacgggctga

DBGET integrated database retrieval system