KEGG   Burkholderia sp. OLGA172: AYM40_05325Help
Entry
AYM40_05325       CDS       T05111                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AYM40_05325
Enzymes [BR:buz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AYM40_05325
Transporters [BR:buz02000]
 Other Transporters
  Pores ion channels [TC:1]
   AYM40_05325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 Tom37 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANB71863
UniProt: A0A161IAV2
LinkDB All DBs
Position
1:1230337..1230984
Genome map
AA seq 215 aa AA seqDB search
MIKLCGFALSNYYNKVKFVLLEHGIPFEEVFVLPSQEETMLEHSPLGKVPYIQTEHGDLC
ESQCIVEYLAARFPDKAIFAADPWEAAKERELITFVDVHLELTARNLYKEAFFGGTVTDA
TKGRVEKLLARHVLGFRRIAKFGPYLSGERFSVADAAGYVSLPLVGMATQTIYGRDFLLD
AGVDWKSYVKAIKARPAAQRVTEDRKAYIAASRPA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgtgcggtttcgcgctctctaactattacaacaaggtgaagttcgtgctg
ctcgaacacggcattccgttcgaggaagtgttcgtgctgccgagccaggaagagacgatg
ctcgagcattctccgctcggcaaggtgccctatatccagaccgagcacggcgatctgtgc
gaatcgcaatgcatcgtcgagtatttggccgcgcgttttcccgacaaggcgattttcgcc
gcagacccgtgggaagcggccaaggagcgcgagttgatcaccttcgtggatgtgcacctc
gaactgaccgcgcgcaatctctacaaggaagcgttcttcggcggcaccgtgactgacgcg
accaaggggcgcgtcgagaagctgctcgcgcgtcacgtcctcggcttcaggcggatcgcg
aaattcgggccgtatttgagcggcgagcgtttcagtgtcgccgacgcagcaggttatgtg
agcttgccgctggtcggcatggcgacgcagaccatctacggccgcgacttcctgctcgac
gccggcgtggactggaaaagctatgtgaaggcaatcaaggcccggccggccgcgcagcgc
gtgaccgaagatcgtaaggcgtatatcgcggcctcgcgtccggcctga

DBGET integrated database retrieval system