KEGG   Burkholderia sp. OLGA172: AYM40_08080Help
Entry
AYM40_08080       CDS       T05111                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00020  Citrate cycle (TCA cycle)
buz00310  Lysine degradation
buz00380  Tryptophan metabolism
buz01100  Metabolic pathways
buz01110  Biosynthesis of secondary metabolites
buz01120  Microbial metabolism in diverse environments
buz01130  Biosynthesis of antibiotics
buz01200  Carbon metabolism
Module
buz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AYM40_08080 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    AYM40_08080 (sucA)
   00380 Tryptophan metabolism
    AYM40_08080 (sucA)
Enzymes [BR:buz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AYM40_08080 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ANB72323
UniProt: A0A167VWV6
LinkDB All DBs
Position
1:1885495..1888356
Genome map
AA seq 953 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEEMYEAYLDNPASVPENWRSYFDALQNVPASDGSNANDVAH
GPIVESFAQRAKANAFIPRTAAGGEDLATSRKQVYVQSLIGAYRFLGSQWANLDPLKRRE
RPAIPELEPAFYDFTEADMDQEFSATNLYFGFERASLREIVKALRDTYCGTIGAEYMYIS
DPEQKRWWKEKLESIRSTPSFSNEKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGES
FIASMDEVVRHGGANGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGD
VKYHKGFSSDVSTDGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDDSGLQVLPVQI
HGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDSRSTLYCSDVVKM
IEAPVLHVNGDDPEAVVLATQLAIDFRMQFHKDVVVDIVCFRKLGHNEQDTPAVTQPLMY
KTIAKHPGTRALYAEKLVQQGVITAAEGDEFVKAYRKAMDEGHHTIDPVLSNYKSKYAVD
WVPFLNRKWTDAADTAVPLAELKRLAERVTTIPENFKVHPLVERVINDRRAMGRGEAKLD
WGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAEG
QAKFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKW
GRVSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIRL
FRKPLIVATPKSLLRHKEAVSDLSELAKGAFQPILGEIDEAIEPKKVKRVVACSGRVYYD
LLAHRRESKSNDVAIIRIEQLYPFAHKQFEAEMKKYDNATEVVWVQDEPQNQGPWFYIEH
HLKEGMKDGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcttatctgttcggcggcaatgctccgtacgtagaa
gaaatgtacgaagcgtatctcgacaatccggcgtcagtgcccgagaactggcgcagctat
ttcgacgcgttgcagaacgtccctgcatcggatggcagcaatgccaacgacgtggcccat
ggcccgatcgtcgaatcgtttgcacaacgggccaaggctaacgccttcatcccgcgcacg
gcggccggcggcgaagacctcgctacctcccgcaagcaagtctatgtgcagtccctcatc
ggcgcatatcgcttcctcggctcgcaatgggccaatctcgatcccctgaagcgccgcgaa
cgtcccgctatccccgaacttgaacccgcgttctacgacttcaccgaagccgacatggac
caggagttcagcgccacgaatctgtatttcgggttcgagcgtgcgtcgctgcgcgagatc
gtcaaggccctgcgtgacacgtactgcggcacgatcggcgccgagtacatgtacatcagc
gatccggaacagaagcgctggtggaaagagaagctcgagtcgatccggtcgacgccgagc
ttctccaatgaaaagaagaagcacatcctgaatcgcctgacggccgctgaaggcctcgag
cgcttcctgcacaccaagtacgtcggccagaaacgcttctcgctcgaaggcggcgaaagc
ttcatcgcgtcgatggacgaagtcgtgcgtcatggcggcgccaacggcgtgcaggaaatc
gtcatcggcatggcccaccgtggccgtctgaacgtgctggtcaatacactcggcaagatg
ccggcggacctgtttgccgaattcgaaggcaagcacgtcgacgacctgccggccggcgac
gtgaagtaccacaagggtttctcgtcggacgtctcgaccgatggcggcccggttcacctg
tcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcggcg
aaggcccgtatggatcgccgcggcgatgacagcggcctgcaagtgctgccggtgcagatt
cacggcgacgcggctttcgcaggtcaaggcgtcgtgatggaaacgctgaacctcgcgcaa
acgcgcggttacggcacgcacggcacgctgcatatcgtcatcaacaaccagatcggtttc
acgacgtcggacccgcgcgactcgcgttccacgttgtactgctcggacgtcgtcaagatg
atcgaggcgccggtgctgcacgtgaacggtgacgatcctgaagcggtcgtgctggctacg
cagctggctatcgacttccggatgcagttccacaaggacgtcgtcgtcgacatcgtctgt
ttccgcaagctgggtcacaacgagcaggacacgccggctgtcacgcagccgctgatgtac
aagacgattgcgaagcacccgggcacgcgcgcgctgtacgctgaaaagctggtgcaacaa
ggcgtgatcacggcggcagaaggcgacgaattcgtcaaggcctaccgcaaggcgatggac
gaaggccatcacacgatcgacccggtgctctcgaactacaagagcaagtacgcggtggat
tgggtcccgttcctgaaccgcaagtggaccgacgcagccgacacggctgtgccgctggct
gagttgaagcgcctcgctgagcgcgtcaccacgatcccggaaaacttcaaggttcacccg
ctggtcgagcgcgtcatcaacgaccgtcgcgcgatgggccgtggtgaagcgaagctcgac
tggggcatgggcgaacacctggcattcgcgtcgctggtcgcatcgggttatgccgtgcgt
ctgaccggtcaggactcgggccgcggcacgttcacgcaccgccacgcggtgctgcacgat
cagaaccgcgaacgctggaacgacggcacctacgtgccgctgcagaacatcgccgaaggt
caggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctgggcttcgaa
tacggttactcgaccgcggagccgaatacgttcgtcgcgtgggaagcgcagttcggcgac
ttcgtgaacggcgcgcaagtcgtgatcgaccagttcatctcgtcgggcgaagtgaagtgg
ggccgcgtgtcgggtctcacgatgctgctgccgcacggctacgaaggccaaggtccggag
cactcgtcggcacgtatcgagcgtttcctgcaactgtgcgcagaccacaacatgcaggtc
gttcagccgaccacgccggcgcagattttccacctgctgcgccgtcagatgatccgcctg
ttcaggaagccgctgatcgtcgctacgccgaagtcgctgctgcgccacaaggaagccgtg
tcggatctgtccgaactggcgaagggcgcgttccagccgatcctcggcgaaatcgacgaa
gcgatcgagccgaagaaggtcaagcgcgtggtggcctgctcgggtcgcgtgtactacgac
ctgctggcacatcgccgtgaatcgaagtcgaacgacgtcgcgatcatccgtatcgaacag
ctctatccgttcgcgcataagcagttcgaagcggaaatgaagaagtacgacaacgcgacc
gaagtggtctgggtgcaggacgagccgcagaatcaaggcccgtggttctacatcgagcac
cacctgaaggaaggcatgaaggacgggcagaagctggcatacagcggacgtccggcttcg
gcctcgccggcagtcggctactacgcgaagcactacgagcagcagaaggcgttgatcgaa
ggcgctttcggccgcttgaagagcgcgtcgatcgctaaataa

DBGET integrated database retrieval system