KEGG   Burkholderia sp. OLGA172: AYM40_08085Help
Entry
AYM40_08085       CDS       T05111                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00020  Citrate cycle (TCA cycle)
buz00310  Lysine degradation
buz00380  Tryptophan metabolism
buz01100  Metabolic pathways
buz01110  Biosynthesis of secondary metabolites
buz01120  Microbial metabolism in diverse environments
buz01130  Biosynthesis of antibiotics
buz01200  Carbon metabolism
Module
buz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AYM40_08085
  09105 Amino acid metabolism
   00310 Lysine degradation
    AYM40_08085
   00380 Tryptophan metabolism
    AYM40_08085
Enzymes [BR:buz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AYM40_08085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ANB72324
UniProt: A0A160FJF6
LinkDB All DBs
Position
1:1888498..1889772
Genome map
AA seq 424 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
ISNDGDIVVADQVIAKIDTEGTAGAAAVEAEVKPAPAATSAPAAAPAAQAASATGANTAA
SPAAGKLMAEKGLGAGDVAGTGRDGRITKGDVLSAGAPAAKAAPAPAAAPKAAKPSLPDV
KAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNKYK
DKFEKEHGVKLGFMSFFVKAAVHALKKYPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVV
PILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPP
QSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPARL
LLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaagttccccagctttccgagtcggtctcggaagccaccatg
ctgcagtggaagaagaagcccggtgaggctgttgcacaagacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcaccctctgccggcgtgctcgcacaagtg
atctcgaacgacggcgacatcgtcgttgcggatcaggtgatcgccaagatcgataccgaa
ggcacggcaggcgccgctgctgtcgaagccgaagtgaagccggcgcccgccgccacatcg
gcaccggctgctgctcccgccgctcaggctgcatccgcaacgggtgcgaacactgctgct
tcgccggctgccggcaagctgatggccgagaagggtctgggcgcaggcgacgtcgccggc
acgggccgcgacggccgcatcaccaagggcgacgtgctgagcgcaggcgcaccggctgcc
aaggctgccccggcaccggctgccgcaccgaaggctgcgaagccgtcgctgccggacgtg
aaggcgccggcatcggccgaccaatggctgaaggaccgcccggaacaacgcgtgccgatg
tcgcgtctgcgtgcgcgtatcgccgagcgtctgctcgagtcgcagcaaaccaacgccatc
ctcaccacgttcaacgaagtgaacatggcgccggtgatggacctgcgcaacaagtacaaa
gacaagttcgaaaaggaacatggcgtgaagctgggcttcatgtcgttcttcgtgaaggcg
gctgttcacgcgctgaagaaatacccgctcgtaaacgcgtcgatcgacggtaacgacatc
gtttatcacggctacttcgacatcggcatcgcggtcggttcgccgcgtggcctggtggtg
ccgatcctgcgcaacgcagatcagctgagcctcgccgaaatcgaaaagaagattgctgaa
ttcggccagaaggccaaggacggcaagctgtcgatcgaagaaatgacgggtggtacgttc
tcgatctcgaacggcggtgtgttcggctcgatgctgtcgacgccgattatcaacccgccg
caatccgcgattctgggcgtgcacgccacgaaggaacgcgctgtggtcgaaaacggccag
atcgtgatccgtccgatgaactatctggcgctgtcgtacgaccaccggatcatcgacggt
cgcgaagcagtgctgtcgctggtcgcgatgaaggatgcgctggaagatccggctcgcctg
ctgctcgacctgtaa

DBGET integrated database retrieval system