KEGG   Burkholderia sp. OLGA172: AYM40_23410Help
Entry
AYM40_23410       CDS       T05111                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00440  Phosphonate and phosphinate metabolism
buz01100  Metabolic pathways
buz01120  Microbial metabolism in diverse environments
buz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AYM40_23410
Enzymes [BR:buz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AYM40_23410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 IspD NTP_transferase ICL NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ANB75336
UniProt: A0A160FRR6
LinkDB All DBs
Position
2:704781..706502
Genome map
AA seq 573 aa AA seqDB search
MNAREPAFISASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDEHFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAKEIHSSETLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGAAVVLAAGRGKGLEAVTEDRPKVMLPIAGKPLLRWLVDAFKKQSVNDITVVGGYR
ADAIDTAGIKLVVNERHAQTGELASLVCAVDKLAGDTVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVTLRHVSSGQEATSAIASQTPHGRW
VGLLNVRGEGRERLRAVLGKLQARPDFDSLDMPALLNALIEAGEAIEVQYVHGHWRGVND
LDDFRRAGDFAHAQAPFAAAVGNQMGTTSGAAQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcccgtgaacctgcattcatctccgcttcgcgcagcgcacgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggcccacaacgggctctccgcccgtatc
gtccgcgaagccggcttcaaagcgatctggggttcgggcctcgcgatctccgcccaattc
ggcgtgcgcgacaacaacgaagccagctggacgcaagtcgtcgataccctcgaattcatg
gccgacgccagcgatttgcccattctcctcgatggcgataccggctacggtaacttcaac
aacgtgcgccgtctcgtgcgcaaactcgaacaacgcggcatcgccggcgtctgtatcgaa
gacaaacaattcccgaaaacgaatagcttcattaacggcgaagcccagccgcttgccgat
atggacgagttctgcggcaaaatcaaagccggtaaagactcgcagtcggatgaacacttc
tcgatcgtcgcccgcgtcgaagcactcatcgccggctggggcatggacgaagcgctgcgc
cgcgcggaagcctatcggcaagccggcgccgatgcgatcctgattcacagcaagctctcg
cgtcccgatgaaattctcgagttcgcgcgcgaatgggccggccgcgcgccgctcgtcatc
gtgccgaccaagtactacagcacgcccaccgaagtgttccgcgaggctggcatcagcacg
gtcatctgggcgaatcatctgatccgcgcagcgacctcggccatgcaagccgttgccaag
gaaattcattcgagcgagacgcttgtcaacgtcgaagacagcatcgccgcagtcaacgaa
atcttccgtctgcaagacgccgacgaatactcggaagccgaagaccgctatctgtcgagc
ggacgcgcggccggtgcggccgtcgtgctcgcggcaggccgcggcaaggggctcgaagcc
gtcaccgaagatcgtccgaaagtcatgctgccgatcgcgggcaagccgctcttgcgctgg
ctcgtcgatgcgttcaagaagcagagtgtcaatgacatcaccgtggtcggcggttatcgc
gccgatgcgatcgatactgccggtatcaagctggtcgtcaatgagcgtcacgcgcaaacc
ggcgagctggcgtcgctcgtctgcgcagtcgataaactcgcaggcgacaccgtcatctcg
tacggcgatctgctgttccgcagctacatcttgcgcgatctggtcgagagcgaagccgcg
ttcagcgtggtggtcgattcgtcgctgaccgatgcggaaaacgccagcgtgcgcgacttc
gcatggtgctcggcggctgacgatcgcgggctgttcggcaacaaggtcacgctgcgtcac
gtgtcgagcgggcaggaggcaacgtccgccatcgcttcgcaaacgccgcatggccgctgg
gtcggtctgctgaatgtgcgcggcgaggggcgtgagcgtctgcgagcggtactcggcaaa
ctgcaggcgcgcccggatttcgattcgctcgatatgcccgcgctgctgaatgcgctgatc
gaagcgggtgaagcgatcgaagtgcaatacgtgcacggccactggcgcggggtgaacgat
ctggacgacttccgtcgtgccggcgatttcgcacatgcgcaggcgccgttcgcggcagcg
gtcggcaaccagatggggacaaccagcggggccgcgcaatga

DBGET integrated database retrieval system