KEGG   Burkholderia sp. OLGA172: AYM40_27300Help
Entry
AYM40_27300       CDS       T05111                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
buz  Burkholderia sp. OLGA172
Brite
KEGG Orthology (KO) [BR:buz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AYM40_27300
Enzymes [BR:buz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AYM40_27300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like K_oxygenase FAD_oxidored Glutaredoxin NAD_binding_8 Thi4 DAO FMO-like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ANB75995
UniProt: A0A160FSE3
LinkDB All DBs
Position
2:complement(1624658..1626250)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKSYLEKVSRPIEIVASLDDSAKSQELLALLNDIGTLSERVAVIERRGDSE
RKPSFSIGEPGKETGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFMNGEV
FGQGRSGVKEILAKLDTNAGARAARELEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKCYEVDIMDVQRAEALIPGRINE
VRLANGAVLKAKTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLFEFGAQLRADEVLQRKLRSLANVTIVTQAQTTEITGDGKKV
NGLVYKDLRSGETKNIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRSSDAEEVVSEAEAEATV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctcaagactcagttgaaatcctacctcgaaaaggttagcaggcct
atcgagatcgtcgcctcgctcgacgacagcgcgaaatcgcaagagctgctggcattgctg
aacgatatcgggacattgtcggaacgcgtcgccgtgatcgaacgtcgcggcgacagcgag
cgcaagccgtcgttttcgatcggcgagccgggtaaggaaacgggcatccgtttcgccggc
attccgatggggcatgaattcacgtcgctcgtcctcgcgcttttgcaggtcggcggccat
ccggtcaagctcgacgatgcggtgatcgaacagatccgcagcctggacggcgactatcaa
ttcgaaacgtatttttcgctgtcgtgtcagaactgcccggaagtcgtgcaggcactgaac
gtgatggcgctgatcaacccgcgcatccgccacgtggcgatcgacggcgcgctgttccag
aacgaagtcgaagcgcgccagatcatggcggtaccgaccatgttcatgaacggcgaagtg
ttcggccagggccgcagcggtgttaaggaaatcctcgcgaagctcgacaccaatgccggt
gcgcgagcggccagggaactggaaaagaagccggtgttcgatacgctgatcgtcggcggc
ggtcctgcgggcgcggcggctgcgatttactcggcgcgtaagggtatcgcgacgggtgtc
gtggcggagcgcttcggcggccaggtgctcgatacgctggcgatcgagaacttcgtctcc
gtgacggaaacggaggggccgaagttcgccacggcgcttgaacagcacgtgaagtgctac
gaagtcgacatcatggacgtgcagcgcgctgaagcgctgatcccgggccgcatcaacgag
gtgcgtctggcgaacggcgcggtgctgaaggcgaagaccatcattctggcgaccggtgcc
cgctggcgcgaaatcaatgtgccgggcgagcgcgagtaccgtaaccacggcgtggcgtac
tgcccgcattgcgatggtccgctgttcaagggcaagcgcgttgcggtgatcggcggcggc
aactcgggcgtcgaagcggcgatcgatctcgcgggtatcgtgcgtgaagtcacgctgttc
gaattcggcgcacaactgcgtgccgacgaagtgctgcaacgcaagctgcgcagcctcgcc
aatgtgacgatcgtcacgcaggcgcagaccacggaaatcaccggcgacggcaagaaggtc
aatggtctggtctacaaggacttgcgttcgggcgaaacgaagaacatcgaactcgaaggc
gtgttcgtgcagatcggtctcgtgccgaacaccgaatggctgaagggcacggtcgaattg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacttcggtgccgggtgtgttc
gccgccggcgacgtgaccacggttccgttcaagcagatcgtgattgcagtgggcgagggc
gcgaaggcatcgctctccgccttcgatcatctgattcgcagcagtgatgcagaggaagtg
gtgagcgaagcggaagccgaagcgacagtttga

DBGET integrated database retrieval system