KEGG   Burkholderia sp. OLGA172: AYM40_28415Help
Entry
AYM40_28415       CDS       T05111                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00250  Alanine, aspartate and glutamate metabolism
buz00410  beta-Alanine metabolism
buz00430  Taurine and hypotaurine metabolism
buz00650  Butanoate metabolism
buz01100  Metabolic pathways
buz01110  Biosynthesis of secondary metabolites
buz01120  Microbial metabolism in diverse environments
buz02024  Quorum sensing
Module
buz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AYM40_28415
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AYM40_28415
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AYM40_28415
   00430 Taurine and hypotaurine metabolism
    AYM40_28415
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AYM40_28415
Enzymes [BR:buz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AYM40_28415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANB76189
UniProt: A0A160FSU9
LinkDB All DBs
Position
2:complement(1871197..1872582)
Genome map
AA seq 461 aa AA seqDB search
MTFLKSPPSTPDAVADEYAATISGSSLPKYRIPETSSDRRAVFDLVRDELFMDGNSRQNV
ATFCTTYADDEVRRLMDLSIDKNMIDKDEYPQTAEIEMRCVHMLADLWHATKSWKTTGCS
TTGSSEACMLGGLALKWQWKKRRQAQGKPTDKPNFVCGPVQVCWAKFARYFDVEMRQVPL
SGDATGLRPEDLAQYCDENTIGVVATLGITFTCVYEPVKALAGALDALQANVGLDIPIHV
DAASGGFVAPFIQPDLEWDFSVPRVKSINASGHKYGLAPLGVGWVVWRSTQELPDELIFR
VDYLGGDMPTFALNFSRPAGQIIAQYYMLLRLGREGYRHIQQECADTAQALADGLAKIDA
LEMIYDGRGALPAVCYKLKRPETAGFTLFDLSDQVRMRGWQIASYELPAGREDTIVQRVL
IRRGVTRDMTAMLLEDIRHAVAHLTKNPVLHSTAGPTFHHD
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacctttctcaagtccccgccatccacgccggatgccgtcgctgacgaatacgccgcg
acaatctccgggtcttcgctcccgaagtaccggattccggagacatcgtccgaccgccgc
gccgtattcgatctggtgcgcgacgaattattcatggacggcaactcacggcagaacgtc
gcgacgttttgcaccacttacgccgacgacgaagttcggcgcctgatggatctgtcgatc
gacaagaacatgatcgacaaggacgaatatccgcaaaccgccgagatcgaaatgcgctgc
gtgcatatgctcgccgatctgtggcatgccacgaagtcgtggaagaccaccggttgctcg
acgacgggttcgagcgaggcctgcatgctcggtggtctcgcgctcaagtggcagtggaaa
aagcgcaggcaagcgcaaggcaagccgaccgacaagccgaacttcgtctgcggaccggtg
caggtgtgctgggcgaaattcgcccggtacttcgacgtcgagatgcgtcaggtgccactc
agcggcgacgcgaccggactgcggccggaagatctggcccagtattgcgacgagaacacg
atcggcgtcgttgccacgcttggtatcacgttcacctgcgtctatgaaccggtgaaggcg
ctggcgggggcgctcgacgccttgcaagccaatgtcggactcgatatcccgattcacgtc
gatgccgccagcggcggcttcgtcgcaccgttcattcagccggacctcgaatgggacttc
agcgtgccgcgcgtcaaatcgatcaatgcgtcgggccataaatacgggctcgcgccgctc
ggggtcggctgggtcgtctggcgcagcactcaggaactgccagacgaactgatcttccgg
gtcgattatctcgggggcgacatgccgacgtttgcactgaatttctcgcgaccggcggga
cagatcatcgcgcagtactacatgctgctgcgcctgggccgtgaaggctatcgacatatc
cagcaggaatgcgccgacaccgcgcaagctttggcggacggtctggcgaagatcgacgca
ctggagatgatctacgacgggcgcggcgcgttaccggctgtttgctacaagctgaagcgt
ccagaaacagcaggcttcacgctattcgatctgtccgatcaggtgcgcatgcgcggttgg
cagatcgcctcgtacgagttgcctgccggccgcgaggacaccatcgtgcagcgcgtattg
atccggcgcggcgtgactcgcgacatgaccgcgatgctgctcgaggacatcaggcacgcg
gtcgcgcatctgacgaaaaatccggtgctgcattcgaccgccggccctaccttccatcac
gattga

DBGET integrated database retrieval system