KEGG   Burkholderia sp. OLGA172: AYM40_31155Help
Entry
AYM40_31155       CDS       T05111                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00250  Alanine, aspartate and glutamate metabolism
buz00410  beta-Alanine metabolism
buz00640  Propanoate metabolism
buz00650  Butanoate metabolism
buz01100  Metabolic pathways
buz01120  Microbial metabolism in diverse environments
Module
buz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AYM40_31155
   00650 Butanoate metabolism
    AYM40_31155
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AYM40_31155
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AYM40_31155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:buz01007]
    AYM40_31155
Enzymes [BR:buz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AYM40_31155
Amino acid related enzymes [BR:buz01007]
 Aminotransferase (transaminase)
  Class III
   AYM40_31155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANB76643
UniProt: A0A167WGT7
LinkDB All DBs
Position
2:2510097..2511380
Genome map
AA seq 427 aa AA seqDB search
MKNAELKSRKDAATPRGVGVMCDFYAERAENAELWDVEGRRFIDFAAGIAVCNTGHRHPK
ILAAIRDQLDHFTHTAYQIVPYASYVELAEKINARAPGDYPKKTTFFTTGAEAVENAIKI
ARAATGRPGVIAFTGGFHGRTMMGMALTGKVAPYKIGFGPFPADVFHAPFPNPLHGVTTA
DSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPAEFVRALRKLCNEHGILLIADEV
QTGFARTGKLFAMHHYDVVPDLMTMAKSLAGGMPLSGVVGRADLMDAAAPGGLGGTYAGN
PLAVASAHAVLDIIDEEKLCERATVLGDRVKAKLIALQGEVPQIADVRGPGGMVAVEFCK
AGGTEPDADFTKRVHTLALERGLLLLVCGVYSNVVRFLFPLTIQDSVFDEAMGILEAVLK
ETVSVAV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgctgaactgaagagccgcaaagacgctgccacgccgcgcggcgtcggggtg
atgtgcgatttctacgccgagcgcgcggagaacgccgagttgtgggacgtcgaaggccgc
cgtttcatcgatttcgccgcgggtattgcggtgtgcaatacgggccaccgtcacccgaag
attctggcggcgatccgcgaccagctcgatcatttcacacacaccgcgtatcagatcgtg
ccgtacgcgtcgtacgtcgagctggctgagaagatcaacgcgcgtgcgccgggcgactat
ccgaagaaaaccaccttcttcacgacgggcgccgaagccgttgaaaacgcgatcaagatc
gcgcgtgccgcgactggccgtccgggcgtgatcgcattcaccggcggtttccatggccgc
acgatgatgggcatggcgctgactggcaaggttgcgccgtacaagatcggctttgggccg
ttcccggcggacgtgttccacgccccgttcccgaatccgctgcatggcgtgacgacggct
gattcgctgaaggcgatcgagtttctgttcaaggccgacatcgatccgaagcgcgtcgcg
gcgattattttcgaaccggttcagggcgaaggcggtttctatccggcgccggccgagttc
gtgcgcgccttgcgcaagctgtgcaacgagcatggcattttgctgattgccgatgaagtg
cagacgggttttgcccgtaccggcaagttgttcgcgatgcatcactatgacgtggtgcct
gatctgatgacgatggccaagagtctggcgggcgggatgccgttgtcgggtgtggttggc
cgtgctgacttgatggatgcggcggcgcctggcggcctgggtggcacctatgcgggtaac
ccgctggcggtggcttccgcgcatgccgtgctcgatatcatcgatgaagagaagctctgc
gagcgggctacggttttgggtgaccgtgtcaaggcgaagctgatcgcgcttcagggcgaa
gttccgcagatcgccgatgtgcgcgggccgggcgggatggtggctgttgagttctgcaag
gcaggcgggacggagccggatgccgacttcaccaagcgggtgcacacgctggcgcttgag
cgcgggttgttgctgctggtttgtggtgtttattcgaacgtggttcggttcctgttcccg
cttacgattcaagactccgtctttgatgaggcgatggggattctggaagctgtgcttaag
gaaactgtttctgtagctgtttga

DBGET integrated database retrieval system