KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_137Help
Entry
BVAF_137          CDS       T01398                                 

Gene name
ftsI
Definition
(GenBank) peptidoglycan synthase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00550  Peptidoglycan biosynthesis
bva01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bva00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BVAF_137 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BVAF_137 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bva01011]
    BVAF_137 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bva03036]
    BVAF_137 (ftsI)
Enzymes [BR:bva01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BVAF_137 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:bva01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BVAF_137 (ftsI)
Chromosome and associated proteins [BR:bva03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BVAF_137 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADV33544
UniProt: E8Q5P7
LinkDB All DBs
Position
161630..163330
Genome map
AA seq 566 aa AA seqDB search
MIFFKNRRLYIAYSGVFFMFFILSARLIYLQIISSDHLINESNKRVLRIKSVSESRGMIT
DRMGRVLAVNVPTTSIWVDPKVVHKCSEMNFDIVKWSALSSILGLSLKKLLCFINQHNLD
RFLYLARRIDSAIAEHISQLKLPGVYIQQESKRYYPAGSAAAHLVGVTNVDNQGIEGVEK
SFNGWLAGSPKTRLVYQDRLGRVVEDINLLNEGQLSKSIELSIDERLQYVAYHELNNAVN
IHKAKSGSVVLIDINTGEILAIANSPSYNPNNFSSIKQSMMRNRAITDVFEPGSTVKPIV
IMTALQHDIIKKDSIINTLPYMINGHRIKDVSFNNQLTISEILKKSSNVGVSKLALAMPV
SILLNSYLNFGMGQSTNVGLIGENKGKLYSSNRYDSDIERAALSYGYGLMITPLQLARMY
AIIGGLSLSRQISIIKLDKSKSIPLISPSSNQIFSKSLMRTVINMMEVTTTSHSGCHQAA
IEGYRVAVKTGTIKKVGSQGKYINKYIACTAGIAPVSNPRFALVVVIDDPKNGFYYGGMV
SAPVFKSIMSSTLKIMNVDPDCFNNI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgattttttttaagaatagacgtttatatatagcatatagtggtgttttttttatgttt
tttattttaagtgcaagattaatttatttgcagattatatcttcagatcatttgatcaat
gaaagtaataaacgtgtattaagaataaaaagtgtttccgaatctcgaggaatgattact
gataggatggggcgagtattagcagttaatgtgccgactacatcgatttgggttgatcct
aaagtagttcataaatgtagtgagatgaattttgatattgttaagtggagtgcgttatct
agtattttaggtttgtctttaaaaaaattattatgttttataaatcaacataatttagat
cgttttttatatttagcacgtcggatagattccgctatagcagaacatataagtcaatta
aaattgccaggagtatatatacagcaagaatcgaaacgatattaccctgcagggtctgca
gcagctcatcttgttggagtaaccaatgtagataatcaagggattgaaggggtagaaaaa
agttttaatggctggttggctggttctcctaaaactagattggtttatcaggatcggtta
ggtagagtggttgaagatattaatttattgaatgagggccaactttctaaaagtattgaa
ttaagtatcgatgaacgtttacaatatgtagcatatcatgaattaaataatgctgttaat
atacataaagcaaagtctggtagcgtagttttaatagatattaatactggagagatttta
gctatagcaaatagtccatcatataatcctaataatttttcatccataaaacagtccatg
atgagaaatagagcaattactgatgtttttgaaccagggtcgacggttaaacctattgtg
ataatgacagcattacaacatgatattataaaaaaagatagtataattaatacgttacct
tatatgattaatggacatcgaataaaagatgtatcttttaataatcaattaactattagt
gaaattttaaaaaagtctagtaatgttggtgtttctaaattggcattggctatgccagta
tctattttgttaaattcatatttaaattttggtatgggacaatcaacaaatgttggattg
ataggagaaaataaaggtaaattatattcgtctaatcgatatgattcagacatagaacgt
gcggctctttcatatggatatggattaatgattactccgttacaattagctaggatgtat
gctattattggaggattaagtttatctcgtcagatttctatcataaagcttgataaatcc
aaatccattcctttaatatctccatcatcaaatcaaatattttcaaaatcattgatgcgc
actgttatcaatatgatggaagttactactacgtctcatagtggttgtcatcaagcagcg
atagaaggatatcgagttgcagttaagacgggtactattaaaaaagttggatctcaagga
aaatatattaataaatatatagcatgcactgcaggaatagccccggttagtaatccaagg
tttgcattagtcgtggtgattgatgatccaaaaaatggattttattatggagggatggta
tctgcgccagtgtttaaatctattatgagcagtactttaaaaataatgaatgtggatcca
gactgtttcaataatatatga

DBGET integrated database retrieval system