KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_155Help
Entry
BVAF_155          CDS       T01398                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bva00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BVAF_155 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bva01003]
    BVAF_155 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bva01011]
    BVAF_155 (mrcB)
Enzymes [BR:bva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BVAF_155 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BVAF_155 (mrcB)
Glycosyltransferases [BR:bva01003]
 Polysaccharide
  Bacterial polysaccharide
   BVAF_155 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:bva01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BVAF_155 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ADV33562
UniProt: E8Q5R5
LinkDB All DBs
Position
189421..191862
Genome map
AA seq 813 aa AA seqDB search
MHKINLIFGCLKLVSIFFKKIVFINYFFLKNCLKIIINIFFFTHYGIYVLLCVVILLCFY
GIFLDKKIQNHINDQVWQLPTVIYSKIVNIEPNISCNKNDMIKLLQSLQYRQVSKIIRSG
EFVVFNDNIELLRRSFDFPNREEQESHVRLFFDKEKLLRIYNQDTQNNFALFRIDPKIIS
IQYVFQGQQRLFVPRSKFPDTLIDMLLAVEDKNFYNHDGIQIPSVIRAFLINIVSGHTVQ
GGSTITQQLVKNLFLNNTRSLWRKFNEMYMALIFEVRYSKDRILELYLNEIFFGQNGNDQ
IRGFPLASFHYFGRPVDELSLDQQAMLVGMIKGASLYSPRKNPKKTLERRNFILNLLRNI
DMIDADLYSILKSRPLGVQLKDEVLTNQPAFIQMVYEEVSRINKIHNLAGLRIFTTLDPI
AQQAAERSMKLGIPKLRCSSNISDLEGAIIIVDRFNGSVRAMVGGSEPNFSGFNRAMRAR
RPIGSLIKPAIYLTALNQPHKYRLNTWIADTPINLKQPDGSVWSPKNYDRQFRGKVMLID
AFVKSLNIPAVNLGLTMGINTITDILMKLGISENLIPSFPSILLGSINLTPINVAQEYQT
IASGGRYSKLSCIEHIVNSDNMTVYQYFPKTKRMVSPQSVYLVLFAMQQVVTRGTSYDLS
VKFADFHLAAKTGTTNDSRDSWFVGIDGKEVVVIWVGRDDNGKMNLTGASGALKLYSLYL
GLGHPTPLQLTIPSNIIQVPINSSGSVLLYNNCNKNIYTYVLPIWKNDHFNGIECNMLNS
SDEVIAYSGNVLDFSENQDFRKMEKWINEILKE
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaattaatttaatttttggttgtttgaaattagtaagtattttttttaaaaaa
attgtctttataaattatttttttttaaaaaattgtctgaaaataataattaatatattc
ttttttacacattatggtatatatgtattgttatgtgttgtaattttgctttgtttttat
ggtatttttttggataaaaaaatacaaaatcatattaatgatcaggtatggcaattgcct
acagttatatatagtaaaattgtgaatattgaaccaaatatatcatgtaataagaatgac
atgattaaattgttacagtcattacaatatcgtcaagtatctaaaattattcgatcaggt
gaatttgttgtatttaatgataatattgaattattacggagatcttttgattttcctaat
agagaggaacaagaaagtcatgtacgtttattctttgataaagaaaaattgttgcgtatt
tataatcaagatacgcaaaataatttcgctttgtttcgtatagatccaaaaattatatct
atccagtatgtttttcaggggcaacaaagattgtttgtgcctcgatctaaatttccagat
acattaatagatatgttattagctgtggaagataaaaatttttataatcatgatgggatt
caaataccttcagtaatacgagcttttttaattaatattgtatctggtcatactgtacaa
ggaggaagtactataacacaacaattagtaaaaaatttatttttaaataatactcgatca
ttatggcgtaaatttaatgaaatgtatatggctttgatttttgaggttcggtatagtaaa
gatcgcattcttgagttatatttaaatgagattttttttggtcaaaacggtaatgatcaa
attcgaggatttcctttagccagttttcattattttggcaggccggttgatgagttaagt
ttagatcaacaagctatgttagttgggatgataaaaggcgcttctttgtatagtcctcga
aaaaatccaaaaaaaacactagaacgtcgtaattttatattaaatttattgagaaatatt
gatatgattgatgctgatttgtatagtatacttaaatctcgtcctttaggagtacaatta
aaagatgaggtattaactaatcagcctgcttttattcaaatggtatacgaagaagtaagt
cgtataaataaaattcacaatttggctggtttaagaatatttactacattggatccaatt
gctcaacaagctgctgaaagatcaatgaaattaggcattccaaaattaagatgtagttct
aatatatcagatttagaaggggctataataattgtagatcgatttaatggatcggtacgc
gctatggttggtggatctgaacctaatttttccggatttaatagagctatgcgtgcccgt
cgtcctattggatcattaattaaaccagcaatttaccttactgctctaaatcagcctcat
aaatatcgtttaaatacgtggattgcagatacccctattaatttaaaacaaccagatgga
tcagtatggtcgcctaaaaattatgatcggcaatttagagggaaagttatgttaattgat
gcatttgtaaaatctcttaatattcctgctgttaatttaggattaacaatgggaataaat
actattactgatattttaatgaagttgggtatttctgagaatttaattccttcttttccg
tcgattttattaggatctattaatttaactccaataaatgtagctcaggaatatcaaact
atagcgagtggaggacgatactctaaattatcttgtatagaacatattgtaaactcagat
aatatgactgtatatcaatattttcctaaaactaaacgtatggtttctcctcaatccgtg
tacttggttttgtttgcaatgcagcaagttgtaacaagaggcacatcttatgatttgtca
gtaaaatttgctgattttcatttagctgctaaaacaggcacaacaaatgattctcgtgat
agttggtttgtgggaattgatggtaaagaagtagttgtaatctgggtaggtcgtgatgat
aatggaaaaatgaatttaacaggtgctagtggggcattaaaattatatagcctttattta
gggcttgggcatcctactccgttacaattaacaataccgagcaatattattcaagttcct
ataaattcgtctggcagtgtgcttttgtataataattgtaataaaaatatttatacgtat
gttttgccaatatggaaaaatgatcattttaatggtatagaatgcaatatgcttaattcg
tcagatgaggtgattgcgtattctgggaatgtactcgatttttcagaaaatcaagatttt
cgaaagatggaaaagtggattaacgaaattcttaaggaatag

DBGET integrated database retrieval system