KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_285Help
Entry
BVAF_285          CDS       T01398                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00061  Fatty acid biosynthesis
bva00780  Biotin metabolism
bva01100  Metabolic pathways
bva01212  Fatty acid metabolism
Module
bva_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BVAF_285 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BVAF_285 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bva01004]
    BVAF_285 (fabZ)
Enzymes [BR:bva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BVAF_285 (fabZ)
Lipid biosynthesis proteins [BR:bva01004]
 Fatty acid synthase
  Component type
   BVAF_285 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ADV33683
UniProt: E8Q6T6
LinkDB All DBs
Position
317001..317468
Genome map
AA seq 155 aa AA seqDB search
MVIDASMLSIEEVLRLLPHRFPFLLVDRVLNFEKGKFLKALKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSTGKLEPGELYYFAAIDEARFKKPVQPGDQMILNVEFIKE
RCGIARFKGVATVNEEMACEALMMCARRKEIKIDD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
ttggttattgatgctagtatgttatctatagaagaagttttaaggcttttacctcatcgt
ttcccatttttgttagtagatcgtgtgctcaattttgagaaaggaaagtttttaaaagca
ctaaaaaatgtttcatttaatgagcctttttttcaggggcattttccaggaaaacctatt
tttcctggagttttgattttagaggctatggctcaagctacaggaattttagcatttaaa
agcacaggaaaattagaacctggggaattatattattttgcggctatagatgaagcacgt
tttaaaaaaccagtgcaacctggtgatcaaatgatattaaatgttgaatttattaaagaa
agatgtggaattgcccgttttaaaggagtagcaacggttaatgaagaaatggcatgcgaa
gcattaatgatgtgtgctagacgtaaggaaattaaaattgatgattaa

DBGET integrated database retrieval system