KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_331Help
Entry
BVAF_331          CDS       T01398                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00020  Citrate cycle (TCA cycle)
bva00190  Oxidative phosphorylation
bva00650  Butanoate metabolism
bva01100  Metabolic pathways
bva01110  Biosynthesis of secondary metabolites
bva01120  Microbial metabolism in diverse environments
bva01130  Biosynthesis of antibiotics
bva01200  Carbon metabolism
Module
bva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bva_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVAF_331 (sdhA)
   00650 Butanoate metabolism
    BVAF_331 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVAF_331 (sdhA)
Enzymes [BR:bva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BVAF_331 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BVAF_331 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DAO FAD_binding_3 Ribosomal_L29
Motif
Other DBs
NCBI-ProteinID: ADV33725
UniProt: E8Q6X8
LinkDB All DBs
Position
372314..374119
Genome map
AA seq 601 aa AA seqDB search
MVNYNNLPVKEFFSVIIGAGGAGMRVALYISQLGFSCALISKVFPTRSHTVSAQGGITVA
LGNQHEDNWEWHMYDTVKGSDYIGDQNAIEYMCKTGPQAIIELERMGLPFSRLKNGRIYQ
RPFGGQTLFYGKKQAARTASSADRTGHALLHTLYQQNLKNKTIIFSEWYALDLVKNQDGR
VLGCVAFSIETGELIYFKARATVIATGGAGRIYQSTTNAYINTGDGIGMALRAEIPVQDM
EMWQFHPTGIAGIGILVSEGCRGEGGYLLNINGEKFMERYAPNAKDLAGRDVVSRAIIIE
IREGRGYSDIYYGPHVKLKLDHLGKELLELRLPGILELVRTFANIDPVKELIPVFPTCHY
MMGGIPTTIHGQVITINNEKEKYDRIVPGLFAVGETACVSVHGANRLGGNSLLDLIVFGH
ATGLCIHKYILEEEWPPARNATASDIEKSLSRYIKWNSDTQLGSNKESPEKIRKDLQWCM
QNNFSVFREEKTMLRGLEELKEMKERLSNVTLQDKTQQFNTQRIECLELENLLEIAYATA
ISALFRKESRGAHSRYDFPFRDDKNWLCHTLFLPKNNIMIRRNVNMQPKFRPAFLPKARL
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggtaaattataataatttaccagtaaaagaatttttttctgttattataggtgctgga
ggagctggcatgcgtgttgcgttatatatttctcaattgggattttcttgtgctttaatt
tctaaggtatttccaactcgatcacatacagtatctgctcaaggaggtattactgtagct
cttggcaaccaacatgaagataattgggaatggcatatgtatgatacagtaaagggatct
gattacataggagatcaaaatgctatcgaatatatgtgtaaaacaggaccacaagctatt
atagaattagaacgtatgggattaccattttctagattaaaaaatggacgtatttatcag
agaccctttgggggtcaaaccttgttttatgggaaaaaacaagctgctcgaactgcatct
tctgctgatagaaccggacatgcgttgctccatacgttatatcaacagaatttaaaaaat
aaaactattatattttcagaatggtatgcgttggatttagtgaaaaatcaagatggaaga
gtacttggttgtgttgctttttctattgaaactggagaattaatatatttcaaagctcga
gccaccgttattgcaactggaggagctggccgaatttatcaatctactactaatgcgtat
atcaatacaggagatggaattggaatggcattacgagctgaaattcctgttcaagatatg
gaaatgtggcaatttcatcctactgggatagctggtattggcattttagtgagtgaagga
tgtagaggagaaggtggatatttattaaacattaatggggaaaaatttatggagcgatat
gctcctaatgctaaagatttagccggacgagatgtagtatctagagcaattattattgaa
attcgagaaggcaggggttattcggatatatattatggacctcatgttaaattaaaatta
gatcatttaggtaaagaattattggaattacgtttaccaggaattttagaattagttcgt
acttttgctaatattgatcctgtaaaagaattaattccagtttttccaacgtgccattat
atgatgggaggtattccgacgaccattcatggacaagtaattactatcaataatgaaaaa
gaaaaatacgatagaatagttccaggtttgtttgcagttggagaaactgcttgcgtatca
gtacatggtgctaatagattagggggaaattctttactagatttaatagtatttggtcat
gctacaggattatgtatacataaatatattttagaggaagaatggccacctgccagaaat
gctactgcttccgatatagaaaaatctttgtctcgttatattaaatggaatagtgatact
cagttaggatcaaataaagaaagtcctgaaaaaataagaaaagatttacaatggtgcatg
caaaataatttttcagtttttcgagaagaaaaaacaatgttaaggggattagaagaatta
aaagaaatgaaagaaagattaagtaatgttactttacaagataaaactcaacaattcaat
actcaacgtattgaatgtttggaactagaaaatttattagaaattgcgtatgccactgca
atatctgctctttttagaaaagaaagcagaggagcacatagtagatatgattttcctttt
agagatgataaaaattggttatgccatacattatttttaccgaaaaataatattatgatt
cgtagaaacgtaaatatgcagccaaaatttcggcccgcttttttacccaaagctcgttta
tattaa

DBGET integrated database retrieval system