KEGG   Brevundimonas vesicularis: CEP68_00570Help
Entry
CEP68_00570       CDS       T04934                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bvc  Brevundimonas vesicularis
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CEP68_00570
Enzymes [BR:bvc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CEP68_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Thi4 Glutaredoxin NAD_binding_8 FMO-like HI0933_like DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ASE38120
UniProt: A0A1Z3U4P3
LinkDB All DBs
Position
complement(109373..110962)
Genome map
AA seq 529 aa AA seqDB search
MLDANLKSQLEAYLKNIVHPVELVASLGAGPKSIELKTLLEEIVSVSHGKVEMGRDYDDE
RQPSFLIRRKGTDIGVRFAGIPLGHEFTSLVLALLHVGGHPSKAAQEVIQQVRDLDGDYV
FETYFSLSCQNCPDVVQALNLMSVINPRIKHVAIEGGLFKDEVEERKIMAVPTVFLNGEL
FGQGRMELEQIVAKLDSGAEARAAERLKSKDPFEVLVVGGGPAGAAAAIYTARKGIRTGV
VAERFGGQVLDTMAIENFVSVPYTEGPKLAAHLEQHVREYEVDLMNLQKAAKLVPAKVAG
GLHEVVLENGASLKSRTVILSTGARWRQMNVPGEEQYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLIEYDSELRADAVLQRKLATLPNVRIVTSALTTQVQGD
GEKVTGLSYKDRNSDAHHDVDLEGIFVQIGLVPNTEWLHGAVGLTPRGEIEVDHRGETSQ
PGIFAAGDATTVPYKQIVIAMGEGSKAGLSAFDYMIRTEPAKEAVVEPA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctagacgccaatctgaaatcccagctcgaagcctacctcaagaacatcgtccatccc
gtcgaactggtcgcctcgctgggcgcagggccgaaatcgatcgagctgaagaccctgctg
gaggagatcgtctcggtctcgcacggcaaggtcgagatgggccgcgactatgacgacgag
cgtcagcccagctttctgatccggcgcaagggcacggacatcggggtgcggttcgcgggc
attccgctgggccacgagttcacctcgctggtgctggccctgctgcacgtcggcggccat
ccctccaaggcggcgcaggaggtgatccagcaggtcagggacctggacggcgactatgtg
ttcgagacctatttctcgctgtcttgccagaactgcccggacgtggtgcaggcgctgaac
ctgatgagcgtgatcaatccgcgcatcaaacacgtcgccatcgagggcggcctgttcaag
gacgaggtcgaggaacgcaagatcatggccgtgccgacggtcttcctgaacggcgagctg
ttcggtcagggccggatggagctggagcagatcgtcgccaagctggattccggcgccgaa
gcccgcgcggccgagcgtctgaagtccaaggatccgttcgaggttctggtggtcggcggc
ggtccagccggggcggcggccgccatctatacggcgcgcaagggcattcgcacgggcgtc
gtcgccgaacgcttcggcggacaggtgctggacacgatggcgatcgagaacttcgtctcg
gtcccctataccgaggggccaaagctggcggcccatctggagcaacacgtccgcgagtat
gaagtggacctgatgaacctgcagaaggcggccaagctggtcccggccaaggttgcgggc
ggcctgcatgaggtggtgctggagaacggcgcatcgctgaaatcgcgcaccgtgatcctg
tcgaccggcgcgcgctggcgccagatgaacgtgccgggcgaggagcagtacaagaacaag
ggcgtggcctattgcccgcactgcgacgggccgctgttcaagggcaagcgggtggcggtg
atcggcggcggcaactccggcgtcgaggcggcgatcgacctggcgggcatcgtggcccat
gtgaccctgatcgaatacgacagcgaactgcgggccgatgcggtgctgcagcgcaagctg
gcgaccctgccgaacgtgcggatcgtgacctcggccctgacgacccaggtgcagggcgac
ggcgagaaggtgacgggcctgtcctacaaggaccgcaactccgacgcccatcacgacgtc
gatctggaaggcatcttcgtgcagatcggtctggtcccgaacaccgaatggctgcacggc
gcggtgggcctgaccccgcgcggcgagatcgaggtggatcaccgcggcgagacctcgcag
ccaggcatctttgcggcgggcgacgcgacgaccgtgccctacaagcagatcgtcatcgcc
atgggcgaagggtccaaggcaggtctgtcggccttcgactacatgatccgcaccgagccg
gcgaaagaagcggtggtcgaaccggcgtga

DBGET integrated database retrieval system