KEGG   Brevundimonas vesicularis: CEP68_01095Help
Entry
CEP68_01095       CDS       T04934                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc03030  DNA replication
bvc03410  Base excision repair
bvc03420  Nucleotide excision repair
bvc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bvc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CEP68_01095
   03410 Base excision repair
    CEP68_01095
   03420 Nucleotide excision repair
    CEP68_01095
   03430 Mismatch repair
    CEP68_01095
Enzymes [BR:bvc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CEP68_01095
    6.5.1.6  DNA ligase (ATP or NAD+)
     CEP68_01095
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CEP68_01095
DNA replication proteins [BR:bvc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CEP68_01095
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CEP68_01095
DNA repair and recombination proteins [BR:bvc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CEP68_01095
   NER (nucleotide excision repair)
    Other NER factors
     CEP68_01095
   MMR (mismatch exicision repair)
    Other MMR factors
     CEP68_01095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: ASE41039
UniProt: A0A1Z3UCM3
LinkDB All DBs
Position
complement(218318..220006)
Genome map
AA seq 562 aa AA seqDB search
MRAFAELLDRLSLTASRNAKLVLVRDYLRATPDPDRGWALAALTGDLTFDAAKPAMIRKA
VEGRVDSVLFGWSYDYVGDLAETVALIWPVTPDHRPNREPELAEVVEALRTATRTEVRGL
LEGWLDALEPKGRWALLKLMTGALRVGLSARLAKTAAAMMRPDAVMAPPSPEGDEAQMTL
EALDASAIEEVWHAVEPPYADLFAWLEGRAERPSPDAPGRFRPVMLAVAIDEAVDLPKLS
PVDYAAEWKWDGIRVQAVLEGEVRKLYSRTGDEISAAFPDVMEALAFEGAIDGELIVWRD
GAVAPFGDLQQRLNRKSVDAKAMQAFPAAVVAYDLLAQDGEDLRSLPLRERRARLEALVN
GHTGERLHLSPVVDYADWDQLARLRADPPVGAAAEGLMLKRWDSPYLAGRPKGPWFKWKR
DPHVIDAVLMYAQRGHGKRSSFYSDYTFGVWTPEGALTPVGKAYFGFTDEELKQLDKFVR
DHTIDRFGPVRSVRAERDFGLVLEIAFEGLNRSTRHKSGVAMRFPRVSRIRWDKPAREAN
TIDDVMDLLDAIESGGGRIAKA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttcgccgagctactggaccgcctgtccctgacggcttcgcgcaatgcgaag
ctggtgctggtgcgcgactatctgagagcgacgcccgatccggaccggggatgggcgctg
gcggccctgaccggggacctgacgttcgacgcggccaagccggccatgatccgaaaggcg
gtcgaggggcgggtcgacagcgtgctgttcggctggtcctacgactatgtgggggatctg
gcggagacggtggccctgatctggcccgtgaccccggaccatcggccaaaccgcgagccc
gaattggccgaggtcgtcgaggcgctgaggaccgcgacgcggacggaggtgcgcggtctt
ctggaaggctggctcgatgcgctggagccgaaagggcgctgggcgctgctgaagctgatg
accggggccttgcgcgtggggctgtcggcgcggctggccaagacggcggcggccatgatg
cgcccggacgcggtgatggcgccgccttcgccggagggcgacgaggcgcagatgacgctg
gaggcgttggacgcctcggccatcgaggaggtctggcacgcggtcgagccgccctacgca
gacctgttcgcctggctggagggcagggcggagcggcccagcccggacgcgcccggccgg
ttccggcccgtcatgctggcggtcgccatcgatgaagcggtcgatctgcccaaattgtcg
ccggttgactatgcggccgaatggaagtgggacggcattcgggttcaggcggtgctggag
ggcgaggtccgcaagctctattcgcgcaccggcgacgagatttcggccgcctttcccgac
gtgatggaggcactggcgttcgaaggcgcgatcgatggcgagctgatcgtctggcgcgac
ggggcggtcgcgccgttcggggaccttcagcagcggctgaatcgcaagtcggtggacgcc
aaggcgatgcaggcctttccggctgcggtcgtcgcctatgacctgctggcccaggacggc
gaggatctgcgcagcctgccgctgcgcgagcgtcgggcgcgcctggaggccctggtcaat
ggtcataccggcgagcgactgcatctgtcgccagtggtcgattatgccgattgggatcag
ttggcgcggttgcgagccgatccgccggttggggcggcggccgaggggctgatgctgaaa
cgctgggacagcccctatctggcggggcgacccaagggaccgtggttcaagtggaagcgc
gacccgcacgtcatcgacgccgtcctgatgtacgcccagcgcgggcacggcaagcgctcc
agcttctattccgactacaccttcggcgtctggacgccggaaggcgcgctgacgccggtg
ggcaaggcctatttcggcttcaccgacgaggagttgaaacagctcgacaagttcgtgcgc
gatcacaccatcgaccggttcgggccggtgcggtcggtgcgggccgagcgggacttcggc
ctggtgctggagatcgccttcgagggactgaatcgctcgacccggcacaagtcgggcgtg
gccatgcgcttcccgcgcgtcagccgcattcgctgggacaagccggcgcgagaggccaac
accatcgacgacgtaatggacctgctggacgcgatcgaaagcggcggcgggcggatcgca
aaggcctga

DBGET integrated database retrieval system