KEGG   Brevundimonas vesicularis: CEP68_06665Help
Entry
CEP68_06665       CDS       T04934                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc00620  Pyruvate metabolism
bvc00680  Methane metabolism
bvc01100  Metabolic pathways
bvc01120  Microbial metabolism in diverse environments
bvc01200  Carbon metabolism
Module
bvc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEP68_06665
  09102 Energy metabolism
   00680 Methane metabolism
    CEP68_06665
Enzymes [BR:bvc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CEP68_06665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase LRV
Motif
Other DBs
NCBI-ProteinID: ASE39211
UniProt: A0A1Z3U7G4
LinkDB All DBs
Position
1289529..1292228
Genome map
AA seq 899 aa AA seqDB search
MMSPAADDALRDEVRLLGGILGDIIRDEGGQALFDHVEAVRQASIAYHRDPASHPAKRLE
KLLTAMSVDQAAGLAHGFALFSLLANIAEDRSTRRRAQSQAEAGARPDTPEGALKRLADQ
GVDREAVRALLDQSLISPVLTAHPSEVRRKSVIDRIAAITDLLDACDKAGDACTLDAIAE
PLRRQIVILWATRLVRTQGLVVQDEIDTVVSFLDRIFLHVAPKQLSAWRRLLEAPELKPF
MRVGTWVGGDRDGNPNVDATVMAAAFRTQARAVLTFYLDEVHALGAELSLAAELAQVSPE
LQALADAAHDPSPHRADEPYRRALTGVYARLAATHEKLGDAPPPRRPAVQAEPYPGPDAF
EADLKTLHDSLVLHHGGVFADDRLSDLITAVEVFGFHMATLDMRQNADVHERVVADLLKV
AGVQSDYLALDEEGRLKVLAAELASSRLLFSPYADYEPETLKERAILQAAATALAAFGPQ
AIRTHIVSKTDAASDLLEVYLLLKEVGLYRPEDPAACPIQAAPLFETIEDLRAARPTLER
LLQEPSALAVAKARGVQEVMIGYSDSNKDGSYLTSGWELHEASRALVEVTQKHGLKLQLF
HGRGGTVGRGGGSSFAGVLAQPEGTVQGRIRTTEQGEVIANKYGEPEIALRNLDALTCGA
MLASLGKGTDHAFTAEHGATLSDLSARSMAAYRKLVYETDGFVDYYRAATPIAEIADLKI
GSRPSSRTASTRIEDLRAIPWVFSWSQSRVMLPGWFGFGSAVQGKDMGELKAMAEAWPFF
KTLVQNMEMVMAKSDMTIARRYATLVPDASLAARIYGEIREEWQRTHDAILAITGHDALL
GGQPELDRLIRLRMPYVEPLNHVQIELIRRRRAGDDDPRVREGILLAINGVAAGLRNSG
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccccgccgccgacgacgccctgcgtgacgaggtccgactgctcggcggcatt
ctgggcgacatcatccgcgacgagggcggtcaggccctgttcgaccatgtcgaggcggtg
cgacaggcttcgatcgcctatcaccgcgacccggcctcgcaccccgccaagcggctggag
aagctgctgaccgccatgtcagtggatcaggcggccggcttggcgcacggctttgcccta
ttctctctgctggccaatatcgccgaagaccgctcgacccgccgccgcgcccagagccag
gccgaggccggcgcccggcccgacactccggaaggcgcgctgaagcgtctggccgatcaa
ggcgtggaccgcgaggccgtgcgcgccctgctggatcagtcgctgatctcgcccgtcctg
accgcccacccgtccgaggtccggcgcaagagcgtcatcgaccgtatcgccgccatcacc
gacctgctggacgcctgcgacaaggccggcgacgcctgcaccctggacgccatcgccgaa
ccgctgcgccgccagattgtcatcctgtgggccacgcgcctggtccgcacccaggggctg
gtggtgcaggacgagatcgacaccgtggtctccttcctggaccgcatcttcctgcacgtc
gcgcccaagcagttgtcggcctggcggcggttgctggaggcgcccgagctgaagcccttc
atgcgcgtcggcacctgggtcggcggcgaccgcgacggcaatcccaacgtggacgccacg
gtgatggccgccgccttccgcacccaggcgcgggctgtgctgaccttctatctggacgag
gtgcacgccttgggcgccgaactcagcctcgccgccgaactggcgcaggtgtcgcccgag
cttcaggccctggccgacgccgcccacgacccctcgccccaccgcgcggacgagccctat
cgccgcgccctgaccggcgtctatgctcgcctggccgccacgcacgagaagctgggcgac
gcccccccgccccgtcgccccgcggtccaggccgaaccctatcccggccccgacgccttc
gaagccgatctgaagacgcttcacgacagcctggtattacaccacggcggtgtcttcgcc
gacgaccggctcagcgacctgatcacggcggtcgaggtgttcggcttccatatggcgacc
ctggacatgcgccagaacgccgacgtccatgaacgcgtcgtcgccgacctgctcaaggtc
gcgggcgtccagtccgactatctggcgttggacgaggaaggtcgcctgaaggtgctggcc
gccgaattagcctcgtcgcgcctgctgttcagcccctatgccgactatgagccggaaacg
ctgaaggaacgcgccatccttcaggccgccgcgacagcgctcgccgccttcggcccgcag
gccatccgcactcatatcgtgtccaagaccgacgcggcttccgacctgctggaagtttat
ctgctgctcaaggaggtcggtctctaccgacccgaagaccccgccgcctgcccgattcag
gccgcgcctctgttcgagaccatcgaagaccttcgcgccgcgcgccctaccttggagcgg
ctgttgcaggagccgtcggccctcgccgtcgccaaggcgcgaggcgtgcaggaggtgatg
atcggctattcggattcgaacaaggacggctcctatctgacctcgggctgggagttgcac
gaggcctcgcgcgccctggtcgaggtgacgcagaagcacgggctgaaactgcaactgttc
catggacgaggcggcacggtcgggcgtggcggcggctcgtccttcgccggcgtcctggcc
caacccgaaggcacggtccagggccgcatccgcaccaccgagcagggcgaggtcatcgcc
aacaaatacggcgagccggaaatcgcgcttcgcaatctggacgccctgacctgcggcgcc
atgctggcctctctgggcaagggcacggatcacgccttcaccgccgaacacggcgcgacc
ctgtcggacctgtcggcgcgttcgatggccgcctatcgcaagctggtctatgagaccgac
ggcttcgtcgattactaccgcgccgccacccccatcgccgagatcgccgatctgaagatc
ggctcgcgcccgtcgtcgcgcaccgcctcgacgcggatcgaggatctgcgcgccattccc
tgggtgttcagttggtcgcagagccgggtcatgctgcccggctggttcggcttcggttcg
gcggtgcagggtaaggacatgggcgagctgaaggcgatggccgaggcctggcccttcttc
aagacgctggtccagaacatggagatggtcatggccaagtccgacatgaccatcgcccgt
cgctacgccaccttggtccccgacgcctctctggccgcccgcatctatggcgagatccgg
gaggaatggcagcggacccacgacgccatcctggccatcaccggccatgacgccctgctg
ggcggccagcccgagctggaccggctcatccggttgcgcatgccctatgtcgagccgctg
aaccacgtccagatcgaactgatccgccgccgccgcgcaggcgacgacgacccccgcgtc
cgcgagggcatccttctggccatcaacggcgtggcggcgggattaagaaacagcggctga

DBGET integrated database retrieval system