KEGG   Brevundimonas vesicularis: CEP68_09500Help
Entry
CEP68_09500       CDS       T04934                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bvc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CEP68_09500
Enzymes [BR:bvc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CEP68_09500
Transporters [BR:bvc02000]
 Other Transporters
  Pores ion channels [TC:1]
   CEP68_09500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ASE39714
UniProt: A0A1Z3U9T3
LinkDB All DBs
Position
1843181..1843816
Genome map
AA seq 211 aa AA seqDB search
MSEEIVFYTNPMSRGRIVRWMLEEVGQPYRTVVVAYAAMKSPDYLAINPMGKVPAVAHRG
IVVTECAAICAYLADAFPDAGLAPATDDPLRGLYYRWMFFAAGPVEAAVTAKSLGQLPPP
EKSAMVGYGSFDQVIDGLEHALDRSPWILGERFSAADVYVGSQIAWGLMFKSLPERPAFT
AYAERITTRPAAVRAREIDDALIAEAKAKAD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagagatcgtcttttacaccaaccccatgtcgcgcggacgcatcgtccgctgg
atgctagaggaggtgggccagccctatcgcaccgtcgtggtcgcctatgcggcgatgaag
tcgccggactatctggcgatcaatccgatgggaaaggtgccggccgtcgcccatcgcggg
atcgtggtcaccgaatgcgccgccatctgcgcctatctggccgacgcctttcctgacgcc
ggcctggcgccggcgacggacgatccgctgcgcgggctttattaccgctggatgttcttc
gccgccggaccggtcgaggcggcggtgaccgccaagtcgctgggtcaactgccgccgccc
gagaagtcggccatggtcggctacggctcgttcgatcaggtgatcgacgggctggaacat
gcgctggatcgcagtccgtggattctcggcgagcggttcagcgccgccgatgtctatgtc
ggcagccagatcgcctgggggctgatgttcaagagcctgcctgaacggccggccttcacg
gcctatgccgaacggatcacgacacgcccggccgctgtgcgcgcccgcgaaatcgacgac
gccctgatcgccgaagcgaaagccaaggcggactga

DBGET integrated database retrieval system