KEGG   Brevundimonas vesicularis: CEP68_10145Help
Entry
CEP68_10145       CDS       T04934                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bvc  Brevundimonas vesicularis
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CEP68_10145
Enzymes [BR:bvc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CEP68_10145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ASE39834
UniProt: A0A1Z3UA50
LinkDB All DBs
Position
1982133..1982849
Genome map
AA seq 238 aa AA seqDB search
MTDLSAFPITQRWPVQHPDRIQLYSLPTPNGVKVSIMLEEVGLAYEPHLIDITKNETWGP
EFLSLNPNGKIPAILDPNGPNGKPLALFESGAILIYLAEKTGKLLSGDPATRYETIQWVM
FQMGAIGPMFGQLGFFHRFAGKDYEDKRPRDRYVAESRRLLGVLETRLANDGGEPRDWLV
GDYSIADVATLGWVRNLIGFYEAGEIVGFADFPRVAAWLERGLARPAVQRGLSIPARD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgtccgccttcccgatcacgcaacgctggccggtccagcatcccgaccgc
atccagctgtattccctgccgacgcccaacggcgtgaaggtctcgatcatgctggaggag
gtcggcctggcctacgagccgcacctgatcgacatcaccaagaacgagacctgggggccg
gagtttttgtctctgaaccccaacggcaagatcccggccatcctcgatccgaacggcccc
aacggaaagccgctggccctattcgaatccggcgccattctgatctatctggcggaaaag
accggaaagctgctctcgggcgacccggcgacccgctacgagacgatccagtgggtcatg
ttccagatgggcgcgatcggcccgatgttcggccagctgggcttcttccaccgcttcgcc
ggcaaggactacgaggacaagcgcccgcgcgaccgctacgtcgccgaaagccgccgcctg
ctcggcgtgctggagacgcggctcgccaatgacgggggagagccccgcgactggcttgtc
ggcgactattccatcgcggatgtcgccaccctgggctgggtccgcaacctgatcggcttc
tacgaagcgggcgaaatcgtcggcttcgccgacttcccgcgcgtcgccgcctggctggag
cgtggcctggcgcgccccgccgtccagcgcggcctcagcatcccggcacgcgactga

DBGET integrated database retrieval system