KEGG   Brevundimonas vesicularis: CEP68_16220
Entry
CEP68_16220       CDS       T04934                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc00010  Glycolysis / Gluconeogenesis
bvc00020  Citrate cycle (TCA cycle)
bvc00620  Pyruvate metabolism
bvc01100  Metabolic pathways
bvc01110  Biosynthesis of secondary metabolites
bvc01120  Microbial metabolism in diverse environments
bvc01200  Carbon metabolism
Module
bvc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEP68_16220
   00020 Citrate cycle (TCA cycle)
    CEP68_16220
   00620 Pyruvate metabolism
    CEP68_16220
Enzymes [BR:bvc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CEP68_16220
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N PYNP_C ATP-synt_ab_Xtn
Other DBs
NCBI-ProteinID: ASE40909
UniProt: A0A1Z3UC71
LinkDB
Position
3227144..3228445
AA seq 433 aa
MTDILMPALSPTMEEGVLAKWHVKVGDVVSAGDVIAEIETDKATMEVEAVDEGEVTDILV
AEGTEGVKVNTPIARLKDEGGAAAPKPTERSAAKTEEARKAEVAPAAAEAPKDATPAAPA
PAAPKSDSGDRIFSSPLARRIAAQNGVDLKSIQGTGPHGRIVKRDVEDAGKAPAQPATAS
SASPATTAAEPRKAQSLAQMGIPDGSYDLIPLDGMKKAVARRMVDSVQNVPHFPLFIDCE
IDQLMAVRAKVNKMLEPQGIKVSVNDFVIKAAALALKMVPEANASYTPEGIAMHHNADVS
MAVAIDGGLITPIIKKAETKGLAQIATESKDLAKRARDRKLKPEEFQGGTFSVSNLGMFG
IKQFTSIINEPQGCIMSVGAGEQRAVVKNGQVVPATVMTVTLTCDHRVVDGATGARFLQA
FKPLIEDPVAMLA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaccgacatcctgatgccggccctgtctccgactatggaggagggcgttctggccaag
tggcacgtcaaggtcggggacgtcgtctccgccggagacgtgatcgctgagatcgaaacc
gacaaggcgacgatggaagtcgaggccgtggacgagggcgaagtcaccgacatcctggtc
gctgaaggcacggaaggcgtgaaggtcaatacgccgatcgcccgcctgaaggacgagggc
ggcgcggccgcacccaagccgactgaaaggtcggctgcaaaaacggaagaggcccgcaag
gccgaggtcgctccggctgcggccgaggcgcccaaggacgccacgcctgccgctccggcg
cctgccgcgccgaagtcggacagcggagatcgcatcttctcgtcaccgctcgctcgccgc
atcgccgcccagaacggcgtcgatctgaagtcgatccagggcaccggtccgcacggtcgc
atcgtcaagcgcgacgtcgaggacgccggtaaggcgccggcccaaccggcgaccgcctct
tcggcgtcgcccgccacgaccgcagcggagccgcgcaaggcgcagtcgctggcgcagatg
ggcattccggacggcagctacgacctgatcccgctggacggcatgaagaaggccgtcgcg
cgccgcatggtcgacagcgtccagaatgtgccgcacttcccgctgttcatcgactgcgaa
atcgaccagctgatggccgtgcgcgccaaggtcaacaagatgctggagccgcagggcatc
aaggtctcggtcaacgacttcgtcatcaaggcggccgctcttgctttgaagatggtgccg
gaggccaacgcctcctacacgcccgaaggcatcgccatgcatcacaacgccgatgtctcc
atggcggtggcgatcgacggcggcctgatcaccccgatcatcaagaaggccgaaaccaag
ggtctggcgcagatcgcgacagagtccaaggacctggccaagcgcgcgcgcgaccgcaag
ctgaagccggaagagttccagggcggcaccttctcggtgtccaacctgggcatgttcggg
atcaagcagttcacctcgatcatcaatgagccgcagggctgcatcatgagcgtgggcgcg
ggcgagcaacgcgcggtcgtcaagaacggccaggtcgtgcccgccacggtcatgaccgtg
accctgacctgcgatcaccgcgtggtggacggcgcgaccggcgcccgcttcctgcaggcg
ttcaagccgctgatcgaagatcccgtcgcgatgctggcctaa

DBGET integrated database retrieval system