KEGG   Brevundimonas vesicularis: CEP68_16220Help
Entry
CEP68_16220       CDS       T04934                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bvc  Brevundimonas vesicularis
Pathway
bvc00010  Glycolysis / Gluconeogenesis
bvc00020  Citrate cycle (TCA cycle)
bvc00620  Pyruvate metabolism
bvc01100  Metabolic pathways
bvc01110  Biosynthesis of secondary metabolites
bvc01120  Microbial metabolism in diverse environments
bvc01130  Biosynthesis of antibiotics
bvc01200  Carbon metabolism
Module
bvc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEP68_16220
   00020 Citrate cycle (TCA cycle)
    CEP68_16220
   00620 Pyruvate metabolism
    CEP68_16220
Enzymes [BR:bvc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CEP68_16220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N PYNP_C ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ASE40909
UniProt: A0A1Z3UC71
LinkDB All DBs
Position
3227144..3228445
Genome map
AA seq 433 aa AA seqDB search
MTDILMPALSPTMEEGVLAKWHVKVGDVVSAGDVIAEIETDKATMEVEAVDEGEVTDILV
AEGTEGVKVNTPIARLKDEGGAAAPKPTERSAAKTEEARKAEVAPAAAEAPKDATPAAPA
PAAPKSDSGDRIFSSPLARRIAAQNGVDLKSIQGTGPHGRIVKRDVEDAGKAPAQPATAS
SASPATTAAEPRKAQSLAQMGIPDGSYDLIPLDGMKKAVARRMVDSVQNVPHFPLFIDCE
IDQLMAVRAKVNKMLEPQGIKVSVNDFVIKAAALALKMVPEANASYTPEGIAMHHNADVS
MAVAIDGGLITPIIKKAETKGLAQIATESKDLAKRARDRKLKPEEFQGGTFSVSNLGMFG
IKQFTSIINEPQGCIMSVGAGEQRAVVKNGQVVPATVMTVTLTCDHRVVDGATGARFLQA
FKPLIEDPVAMLA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctgatgccggccctgtctccgactatggaggagggcgttctggccaag
tggcacgtcaaggtcggggacgtcgtctccgccggagacgtgatcgctgagatcgaaacc
gacaaggcgacgatggaagtcgaggccgtggacgagggcgaagtcaccgacatcctggtc
gctgaaggcacggaaggcgtgaaggtcaatacgccgatcgcccgcctgaaggacgagggc
ggcgcggccgcacccaagccgactgaaaggtcggctgcaaaaacggaagaggcccgcaag
gccgaggtcgctccggctgcggccgaggcgcccaaggacgccacgcctgccgctccggcg
cctgccgcgccgaagtcggacagcggagatcgcatcttctcgtcaccgctcgctcgccgc
atcgccgcccagaacggcgtcgatctgaagtcgatccagggcaccggtccgcacggtcgc
atcgtcaagcgcgacgtcgaggacgccggtaaggcgccggcccaaccggcgaccgcctct
tcggcgtcgcccgccacgaccgcagcggagccgcgcaaggcgcagtcgctggcgcagatg
ggcattccggacggcagctacgacctgatcccgctggacggcatgaagaaggccgtcgcg
cgccgcatggtcgacagcgtccagaatgtgccgcacttcccgctgttcatcgactgcgaa
atcgaccagctgatggccgtgcgcgccaaggtcaacaagatgctggagccgcagggcatc
aaggtctcggtcaacgacttcgtcatcaaggcggccgctcttgctttgaagatggtgccg
gaggccaacgcctcctacacgcccgaaggcatcgccatgcatcacaacgccgatgtctcc
atggcggtggcgatcgacggcggcctgatcaccccgatcatcaagaaggccgaaaccaag
ggtctggcgcagatcgcgacagagtccaaggacctggccaagcgcgcgcgcgaccgcaag
ctgaagccggaagagttccagggcggcaccttctcggtgtccaacctgggcatgttcggg
atcaagcagttcacctcgatcatcaatgagccgcagggctgcatcatgagcgtgggcgcg
ggcgagcaacgcgcggtcgtcaagaacggccaggtcgtgcccgccacggtcatgaccgtg
accctgacctgcgatcaccgcgtggtggacggcgcgaccggcgcccgcttcctgcaggcg
ttcaagccgctgatcgaagatcccgtcgcgatgctggcctaa

DBGET integrated database retrieval system