KEGG   Burkholderia vietnamiensis LMG 10929: AK36_1372Help
Entry
AK36_1372         CDS       T03893                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00020  Citrate cycle (TCA cycle)
bve00480  Glutathione metabolism
bve01100  Metabolic pathways
bve01110  Biosynthesis of secondary metabolites
bve01120  Microbial metabolism in diverse environments
bve01130  Biosynthesis of antibiotics
bve01200  Carbon metabolism
bve01210  2-Oxocarboxylic acid metabolism
bve01230  Biosynthesis of amino acids
Module
bve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bve_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK36_1372 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AK36_1372 (icd)
Enzymes [BR:bve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AK36_1372 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phage_SSB
Motif
Other DBs
NCBI-ProteinID: AJY06302
LinkDB All DBs
Position
I:1481559..1482815
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHTYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGIKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGAEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGDVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcatcccttacatcgaaggcgacggtaccggc
ttcgacatcacgccggtgatgatcaaggtcgtcgatgcggcggtcgcgcatacgtacaag
ggcaagcgcaagatccactggatggagatcttcgccggcgagaaggcgacgaaggtgtac
ggcccggacgtatggctgcccgacgaaacgctgcaggtgctgaaggaatacgtcgtttcg
atcaaggggccgctcacgacgccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggagctcgacctctacgtgtgcctgcgcccgatccagtatttcaagggcgtgccg
tcgccggtgcgcgagccgcagaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgagtgggcggccggctccgagcaggcgaagaaggtcatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctcggggatcggcatc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggttatgcgctcgcgcagaaggaattcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcgccgagatcgtcatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgtccggccgaatacgacgtg
atcgcaacgctgaacctgaacggcgactacgtctccgacgcactggccgcgcaggtcggc
gggatcgggatcgcgccgggtgcgaacctgtcggactcggtcgcgatgttcgaggcgacc
cacggcacggcgccgaagtacgcgggcaaggactacgtgaacccgggttccgagatcctg
tcggccgaaatgatgctgcgccacctcggctggacggaagcggccgacacgatcatcgcc
gcgatggagaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgtctgatggaa
ggtgcgacgcaggtgtcgtgctcgggcttcggcgacgtgctgatcgagaacatgtaa

DBGET integrated database retrieval system