KEGG   Burkholderia vietnamiensis LMG 10929: AK36_1860Help
Entry
AK36_1860         CDS       T03893                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00473  D-Alanine metabolism
bve01100  Metabolic pathways
bve01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AK36_1860 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AK36_1860 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bve01011]
    AK36_1860 (alr)
Enzymes [BR:bve01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AK36_1860 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bve01011]
 Precursor biosynthesis
  Racemase
   AK36_1860 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJY06380
LinkDB All DBs
Position
I:2007604..2008674
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRFAGPSKVWAVVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYQPEKYRAAWERARACPAIGQITLMTHFSDADTERGVAEQLATFERGA
ENIAGARSLANSAAVLWHPDTHFDWVRPGIVLYGASPSGLSADIADTGLQPTMTLTSELI
AVQTIAKGQAIGYGSTFSAPARMRIGVVACGYADGYPRVAPEGTPVIVDGVRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNTLPIDDVARHCGTIGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccataccgccgctctcgcgaacaatctctccgtc
gtgcgtcgctttgccggtccgtccaaggtctgggcggtcgtcaaggccaatgcgtacggc
cacggtctcgcgcgcgtgtttcccggcctgcgcggcaccgacggcttcggcctgctcgat
ctcgacgaagcggtgaagctgcgcgagctcggctgggccggcccgatcctgttgctcgag
gggttcttccgctcgaccgacatcgacgtgatcgaccgctacagcctcacgaccaccgtc
cacaacgacgagcagatgcggatgctcgagacggcgcggctgtcgaagcccgtcaacgtg
cagctcaagatgaacagcgggatgaaccggctcggctaccagccggaaaaataccgcgcc
gcatgggagcgtgcgcgcgcgtgcccggcgattggccagatcacgctgatgacgcatttt
tcggatgccgacaccgagcgcggcgtcgccgagcagctcgcgacgttcgagcgcggcgcg
gaaaacatcgccggcgcgcgcagcctcgcgaattcggccgccgtgctgtggcatccggac
acgcacttcgactgggtgcggccggggatcgtgctgtacggcgcatcgccgtcggggctc
tcggccgacatcgccgacacgggcctgcagccgacgatgacgctcacgtccgagctgatc
gccgtccagacgatcgcgaaggggcaggcgatcggctatgggtcgacgttctcggcgccg
gcccggatgcgcatcggcgtcgtcgcgtgcggttacgcggacggctatccgcgcgtcgcg
cccgaaggcacgccggtgatcgtcgacggggtccgcacgcggatcgtcggccgcgtgtcg
atggacatgatcaccgtcgacctgaccccgtgcccgcaggccggcgtcggcgcgcgcgtc
gagctgtggggcaacacgctgccgatcgacgacgtcgcgcgccattgcggaaccatcggc
tatgaattgatgtgtgcggtcgcgcctcgcgtaccggtgcgggctgaataa

DBGET integrated database retrieval system