KEGG   Burkholderia vietnamiensis LMG 10929: AK36_2377Help
Entry
AK36_2377         CDS       T03893                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00020  Citrate cycle (TCA cycle)
bve00310  Lysine degradation
bve00380  Tryptophan metabolism
bve01100  Metabolic pathways
bve01110  Biosynthesis of secondary metabolites
bve01120  Microbial metabolism in diverse environments
bve01130  Biosynthesis of antibiotics
bve01200  Carbon metabolism
Module
bve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK36_2377 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    AK36_2377 (sucB)
   00380 Tryptophan metabolism
    AK36_2377 (sucB)
Enzymes [BR:bve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AK36_2377 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AJY06428
LinkDB All DBs
Position
I:complement(2584446..2585723)
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAQAAAGAAEVQPAAAPAAAAPAAQPAAATASSSAA
ASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLPE
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcaccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacaccgtggtcgccgatcaagtgatcgcgacgatcgacaccgaa
gcgaaggcaggtgctgcgcaagccgcagcgggcgccgcggaagtgcagccggcggcagcg
ccggccgcagcagcaccggccgcacagccggctgccgcaacggcgtcgagctcggccgcc
gcatcgccggccgcagcgaagctgctggccgagaagggtctgtcgacgggcgacgtcgca
ggctcgggccgcgacggccgcgtcacgaagggcgacgcgctcgccgcaggcagcgcaccg
aaggctgcaccggccgccgcaccggcgaagaccgccgctgcgaagccgtcgctgccggaa
gtgaaggtcccggcatcggccacgacctggctgaacgaccgtccggaacagcgcgtgccg
atgtcgcgcctgcgcgcgcgtatcgccgagcgtctgctcgagtcgcagcaaacgaacgcg
atcctgacgacgttcaacgaagtcaacatgcagccggtcatggacctgcgcgcgaagtac
aaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtgcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggtaacgac
atcgtctaccacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctggtc
gtgccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtcggcgatcctcggcgtgcacgcgacgaaggaacgtccggtcgtcgagaacggc
cagatcgtgatccgtccgatcaactacctcgcgctgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctcgaagatccggcacgt
ctgctgctcgacctgtaa

DBGET integrated database retrieval system